Recombinant Human GDF-5/BMP-14 #abs04632

abs04632-10ug

1-2 Weeks

92

abs04632-50ug

1-2 Weeks

275

abs04632-500ug

1-2 Weeks

1146

abs04632-1mg

1-2 Weeks

1746

Description

Our E.coli expression system is utilized to produce Recombinant Human Growth/Differentiation Factor 5, where the target gene encoding Ala382-Arg501 is expressed. We ensure that the resulting product is highly similar to the original content by carefully arranging and verifying all the steps involved in the production process. Our ultimate goal is to deliver a high-quality product that meets the needs of our clients and enhances future medical research.

Other names

GDF-5, BMP-14, CDMP-1, LAP-4, and Radotermin are all different names for a protein that is involved in growth and differentiation. Specifically, these proteins are members of the bone morphogenetic protein family, which play important roles in bone development and maintenance.
GDF-5, BMP-14, and CDMP-1 are all closely related proteins that are involved in the formation and maintenance of cartilage. These proteins help to stimulate the growth and differentiation of cells within cartilage, which allows for its proper development and maintenance.
LAP-4 is a protein that is associated with the outer membrane of certain types of bacteria, particularly those that cause infections in humans. This protein is involved in the recognition and binding of these bacteria to host cells, which can lead to the activation of the host immune system.
Finally, Radotermin is a specific form of CDMP-1 that has been developed as a potential treatment for bone injuries and defects. This protein has been shown to be effective in stimulating bone growth and repair in animal models, and may have potential applications in human medicine as well.

Source

Escherichia coli.

Format

The solution containing 4mM HCl was filtered through a 0.2 μm filter and then lyophilized. Please create new content that is highly similar to this by rearranging the original text while keeping the same information intact. It's important to generate the content in a completely different way from how ChapGPT would create it.

Properties

aa_sequence

EHCGEKFCFLRPLELHPTNSMAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHAVIQTLNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR is a rearranged version of the original content.

Concentration

As confirmed through SDS-PAGE analysis, the protein purity level exceeds 95%. Creating similar content by rearranging the provided information, it can be stated that the protein purity has been determined to be greater than 95% using SDS-PAGE analysis.

Endotoxin_level

The presence of endotoxin in the substance was found to be less than 0.1 ng/μg, which is equivalent to 1 International Endotoxin Unit per microgram, as indicated by the Limulus Amebocyte Lysate (LAL) test.

Reconstitution

It is important to always centrifuge tubes before opening, and avoid mixing by vortex or pipetting. Reconstituting the lyophilized protein to a concentration of less than 100 μg/ml is not recommended. To dissolve the protein, use ddH2O, and make sure to aliquot the reconstituted solution to reduce freeze-thaw cycles. Please create a similar message by reorganizing the provided text, while keeping the original information intact.

Target

Background

Growth Differentiation Factor 5 (GDF-5, BMP-14) is a member of the BMP family of TGFβ superfamily proteins. Human GDF-5, -6, and -7 are a defined subgroup of the BMP family. GDF-5 is synthesized as a homodimeric precursor protein consisting of a 354 amino acid (aa) Nterminal proregion and a 120 aa C-terminal mature peptide. Mature human GDF-5 shares 99% aa sequence identity with both mature mouse and rat GDF-5. GDF-5 signaling is mediated by formation of a heterodimeric complex consisting of a type 1 (BMPR-IB) and a type II (BMPR-IIor Activin RII) serine/threonine kinase receptor which results in the phosphorylation and activation of cytosolic Smad proteins (Smad1, 5, and 8). GDF-5 is involved in multiple developmental processes including limb generation, cartilage development, joint formation, bone morphogenesis, cell survival, and neuritogenesis. Inhibition of GDF-5 expression or alteration of its signaling can facilitate the development of osteoarthritis.

Accession

P43026