
Recombinant Human Interleukin-17A/F Heterodimer/IL-17A & IL-17F (C-6His) #abs04628
Please note that the price mentioned above is only for your reference. For detailed pricing information, we kindly request you to contact our seller, Vecent. This product is for research use only, not for use in diagnostic prodecures or in human.
Description
Catalog-specification | Delivery time | USD price |
abs04628-10ug | 1-2 Weeks | 230 |
abs04628-50ug | 1-2 Weeks | 673 |
abs04628-500ug | 1-2 Weeks | 2353 |
abs04628-1mg | 1-2 Weeks | 3491 |
Please note that the price mentioned above is only for your reference. For detailed pricing information, we kindly request you to contact our seller, Vecent.
Overview | |
Description | Our Mammalian expression system is capable of producing the Recombinant Human IL-17A & IL-17F Heterodimer. The target gene, which encodes Ile20-Ala155 & Arg31-Gln163, is expressed with a 6His tag at the C-terminus. This ensures that the resulting protein has a high affinity for purification and detection purposes. The heterodimeric nature of IL-17A & IL-17F adds to its biological significance, as it has been shown to play a crucial role in inflammation and immune responses. The inclusion of the 6His tag provides an additional means of monitoring the protein's expression and purification processes. |
Other names | IL-17A and IL-17F are two distinct proteins involved in the immune system's response to inflammation. In addition to their individual functions, these proteins can form a heterodimer known as IL-17A/F heterodimer. The IL-17A/F heterodimer is a combination of IL-17A and IL-17F proteins and plays a crucial role in various inflammatory and autoimmune diseases. |
Source | Human Cells |
Format | The solution was filtered through a 0.2 μm membrane and then lyophilized. This dry powder was formed from a solution containing 20mM PB, 150mM NaCl, and a pH of 7.4. It is important to note that the generated content is based on the original text information but has been rearranged for clarity and coherence. |
Properties | |
aa_sequence | PRKMTSTLPFSPQVSTSKRISSEFAATMTPGKSLVSLLLLLSLEAIVKAGITIPRNPGCPNSE DKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINA AENCVDGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMTSTLPFS PQVSTPRSKFKRISSVLSIEFAATMTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQK PESCMMGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINA QGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQVDHHHHHH. |
Concentration | The SDS-PAGE analysis showed that the purity of the sample was more than 95%. To create a similar statement, we can say that based on the SDS-PAGE results, the sample displayed a purity level greater than 95%. |
Endotoxin_level | The result of the LAL test indicates that the concentration is below 0.1 ng/μg (1 IEU/μg). To ensure accuracy, the content generated will be rearranged while maintaining the original information. |
Activity | The effectiveness of inducing IL-6 secretion in NIH-3T3 mouse embryonic fibroblast cells was measured, and the ED50 for this impact was found to be below 0.5 ng/ml. To put it differently, the ability to stimulate IL-6 release was evaluated by examining its potency on NIH-3T3 cells, where the concentration required to achieve half-maximal response was determined to be less than 0.5 ng/ml. |
Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 4mM Hcl. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Target | |
Background | The IL-17 family include IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F. The family is comprised of at least six proinflammatory cytokines that share a conserved cysteine-knot structure but diverge at the N-terminus. All members of the IL-17 family have a similar protein structure, with four highly conserved cysteine residues critical to their 3-dimensional shape, yet they have no sequence similarity to any other known cytokines. IL-17 family members are glycoproteins secreted as dimers that induce local cytokine production and recruit granulocytes to sites of inflammation. IL-17 is induced by IL-15 and IL-23, mainly in activated CD4+ T cells distinct from Th1 or Th2 cells. IL-17F is the most homologous to IL-17, but is induced only by IL-23 in activated monocytes. |
Accession | Q16552 & Q96PD4 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human interleukin-17a/f heterodimer/il-17a & il-17f (c-6his) #abs04628, China recombinant human interleukin-17a/f heterodimer/il-17a & il-17f (c-6his) #abs04628 suppliers
Send Inquiry
You Might Also Like






