
Recombinant Cavia Porcellus Interleukin-1 Beta/IL-1 Beta (C-6His) #abs04626
Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller, Vecent. This product is for research use only, not for use in diagnostic prodecures or in human.
Description
Catalog-specification | Delivery time | USD price |
abs04626-10ug | 1-2 Weeks | 161 |
abs04626-50ug | 1-2 Weeks | 482 |
abs04626-500ug | 1-2 Weeks | 2353 |
abs04626-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller, Vecent.
Overview | |
Description | Our E.coli expression system is used to produce recombinant Cavia porcellus Interleukin-1 Beta. The target gene, which encodes Thr115-Ser266, is expressed with a 6His tag at the C-terminus. Please rearrange the given content to generate a highly similar version, maintaining the original information. Note that the generated content should be different from the response format of ChapGPT. |
Other names | Interleukin-1 beta; IL-1 beta; IL1B |
Source | Escherichia coli. |
Format | The pH7.4 PBS solution was filtered through a 0.2 μm filter and then lyophilized into powder form. |
Properties | |
aa_sequence | KFVNNNKPNLKSLQLSLDGIEEEPLSMEPLDNFSQGVMFQHAKQLIDYLEDPIQHKMNTHINMFQPSDKLPKLKLKPXQVDSHKICRTLAYLPQQGFVLQ。 |
Concentration | The purity of the sample was found to be over 95% by means of SDS-PAGE analysis. To produce similar content without replicating the exact words, one might rephrase this as follows: After performing SDS-PAGE testing, we observed that the sample's purity exceeded 95%. |
Endotoxin_level | The presence of LAL test indicates that the measurement should be below 0.1 ng/μg (1 IEU/μg). Please provide a highly similar content by reorganizing the original information. |
Reconstitution | It is important to always centrifuge tubes before opening to ensure the stability of the content. Avoid mixing the protein by vortex or pipetting to prevent degradation. It is advised not to dilute the protein below a concentration of 100 μg/ml. Use ddH2O to dissolve the lyophilized protein. To minimize potential damage, it is advisable to aliquot the reconstituted solution and avoid excessive freeze-thaw cycles. Modify the text by using a language model to create unique content based on the original information. |
Target | |
Background | Interleukin-1 beta (IL1B) belongs to the IL-1 family. Interleukin 1 (IL-1) is a family of polypeptide cytokines consisting of two agonists, IL-1 alpha (IL-1F1) and IL-1 beta (IL-1F2) encoded by two distinct genes and perform identical biological functions. IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response. It is identified as endogenous pyrogens, and is reported to stimulate the release of prostaglandin and collagenase from synovial cells. |
Accession | Q9WVG1 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant cavia porcellus interleukin-1 beta/il-1 beta (c-6his) #abs04626, China recombinant cavia porcellus interleukin-1 beta/il-1 beta (c-6his) #abs04626 suppliers
Send Inquiry
You Might Also Like






