Recombinant Rat Stem Cell Factor/SCF (C-6His) #abs04625

abs04625-10ug

1-2 Weeks

138

abs04625-50ug

1-2 Weeks

382

abs04625-500ug

1-2 Weeks

1711

abs04625-1mg

1-2 Weeks

2328

Description

Our E.coli expression system produces Recombinant Rat Stem Cell Factor. The target gene, which encodes Gln26-Ala189, is expressed with a 6His tag at the C-terminus. Please rearrange the information from the original text to generate a highly similar content.

Other names

MGF, also known as Kit ligand or hematopoietic growth factor KL, is an essential factor involved in the growth and development of mast cells. Additionally, MGF plays a critical role in regulating the functions of stem cells. It is commonly referred to as the mast cell growth factor or stem cell factor. With its multiple names such as Steel factor and SCF, MGF has been extensively studied and found to have diverse functions in various biological processes. Its significance in hematopoiesis and cell differentiation makes MGF an intriguing molecule for further investigation. The overlapping roles of Kit ligand and MGF highlight the complexity of this growth factor and its crucial involvement in cellular homeostasis.

Source

Escherichia coli.

Format

The substance was subjected to lyophilization after being filtered through a 0.2 μm pore size filter and suspended in a PBS solution at pH 7.4. Can you please provide a similar passage using different language and sentence structure, but conveying the same information as the original text?

Properties

aa_sequence

VDKKDTNPCERVNEDINLPKLVDIGSMAAGMNDVLPSWDDTHTLNTSLTVCELNDVQAFDYKIWLSNPDSNEGELIYMKIIDDVGSADLTPMVKKKESNFPTRHAFEISFNSOAFLMPPMTHHAKRSIDAAFDKFVDSIDCTQPGKEKDTNIDSLNVRMITLYCRPEISLWDLVRDKVTLNTLLSQMDFSS

Concentration

Based on the results of reducing SDS-PAGE, it has been determined that the protein purity is greater than 95%. To rephrase this sentence, the purity of the protein has been verified to be in excess of 95% through SDS-PAGE reduction.

Endotoxin_level

According to the LAL test, the concentration of endotoxin is less than 0.1 ng/μg (1 IEU/μg). To provide similar content, the text could be rephrased as: The LAL test has determined that the amount of endotoxin present is no greater than 0.1 ng/μg (1 IEU/μg).

Reconstitution

Centrifuging tubes before opening is essential, while vortexing or pipetting should be avoided. It is not advisable to dissolve the lyophilized protein to a concentration lower than 100 μg/ml. Use ddH2O to reconstitute the protein. To prevent damage, it is recommended to aliquot the reconstituted solution and minimize freeze-thaw cycles. Please note that the generated content should be significantly different from the original text, rather than using ChapGPT to generate content in a conversational manner.

Target

Background

Stem cell factor (SCF), is the ligand for the receptor-type protein-tyrosine kinase KIT. It plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. It also promotes phosphorylation of PIK3R1, which is the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5.

Accession

P21581