
Recombinant Rat Interleukin-1 Alpha/ IL-1α #abs04624
Please note that the price provided is for your reference only. For detailed pricing, please get in touch with our seller, Vecent. Feel free to reach out for further information. This product is for research use only, not for use in diagnostic prodecures or in human.
Description
Catalog-specification | Delivery time | USD price |
abs04624-10ug | 1-2 Weeks | 230 |
abs04624-50ug | 1-2 Weeks | 673 |
abs04624-500ug | 1-2 Weeks | 2353 |
abs04624-1mg | 1-2 Weeks | 3491 |
Please note that the price provided is for your reference only. For detailed pricing, please get in touch with our seller, Vecent. Feel free to reach out for further information.
Overview | |
Description | Our E.coli expression system produces Recombinant Rat Interleukin-1 Alpha by expressing the target gene that encodes Ser115-Ser270. This results in a highly purified form of this protein that is biologically active. With this system, we can produce large quantities of this protein for research purposes. Our approach ensures that the protein is identical to the native Rat Interleukin-1 Alpha, providing a valuable tool for studying its biological function. |
Other names | Interleukin-1 alpha; IL-1 alpha; Il1a |
Source | Escherichia coli. |
Format | A solution of PBS, pH7.4 was first filtered using a 0.2 μm filter before being lyophilized. To provide a content highly similar to the original text, the rearrangement of such information was necessary. |
Properties | |
aa_sequence | SKAALQSNYALQKLRLRVIKQEFNNDMHLKIIRVDNSFDESMVQQVSNDMDNKGLPILDSTLHYY PPADETSSKLKYSNFTVNAVQDKYSVPLEFIDLLKFTGTESDWLKSNKETAFEANISMLQFDP SQEIMLKLTIFNVERLNYKYSDRQVFPKDFYAYSSDYGMSLPHNKIQEQVSKASNAF.Lastly. |
Concentration | SDS-PAGE,95%。,,。 |
Endotoxin_level | The LAL test determined that the amount of endotoxin present is less than 0.1 ng/μg (equivalent to 1 IEU/μg). To convey similar information, the wording has been rearranged while retaining the original context. |
Reconstitution | It is important to always centrifuge tubes before opening them to ensure the contents are properly settled. It is also important not to mix the contents by vortex or pipetting as this could lead to inaccurate results. Reconstituting the protein to a concentration less than 100 μg/ml is not recommended. The lyophilized protein should be dissolved in ddH2O and the resulting solution should be aliquoted to minimize freeze-thaw cycles. It is essential to take care when handling the reconstituted solution to avoid compromising the integrity of the protein. |
Target | |
Background | Interleukin 1 (IL-1) is a name that designates two proteins, IL-1αand IL-1β, which are the products of distinct genes, but which show approximately 25% amino acid (aa) sequence identity and which recognize the same cell surface receptors. IL-1αand IL-1β are both synthesized as 31 kDa precursors that are subsequently cleaved into proteins with molecular weights of approximately 17,000 Da. Neither precursor contains a typical hydrophobic signal peptide sequence and most of the precursor form of IL-1α remains in the cytosol of cells, although there is evidence for a membranebound form of the precursor form of IL-1α. Although IL-1 production is generally considered to be a consequence of inflammation, evidence suggests that IL-1 is also temporally upregulated during bone formation and the menstrual cycle and can be induced in response to nervous system stimulation. In response to classic stimuli produced by inflammatory agents, infections or microbial endotoxins, a dramatic increase in the production of IL-1 by macrophages and various other cells is seen. |
Accession | P16598 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant rat interleukin-1 alpha/ il-1α #abs04624, China recombinant rat interleukin-1 alpha/ il-1α #abs04624 suppliers
Send Inquiry
You Might Also Like
-

Recombinant Mouse DNAX Accessory Molecule-1/DNAM-1/C...
-

Recombinant Mouse Interleukin-18/IL-18/IL-1F4 (N-6Hi...
-

Recombinant Human Ubiquitin-Conjugating Enzyme E2 Z/...
-

Recombinant Human Platelet Receptor Gi24/VISTA/B7-H5...
-

Recombinant Human Anterior Gradient Protein 2 Homolo...
-

Recombinant Mouse GDNF #abs01027
