Recombinant Mouse DNAX Accessory Molecule-1/DNAM-1/CD226 (C-6His) #abs04570

abs04570-10ug

1-2 Weeks

146

abs04570-50ug

1-2 Weeks

382

abs04570-500ug

1-2 Weeks

2353

abs04570-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system is used to produce Recombinant Mouse DNAX Accessory Molecule-1, which features a target gene that encodes Glu19-Pro254. The protein is also fused with a 6His tag at the C-terminus. This ensures a highly efficient and reliable production process, resulting in a pure and high-quality product for research applications.

Other names

CD226, also known as DNAM-1 or DNAX accessory molecule-1, is an antigen expressed on the surface of platelets and T cells that plays a key role in their activation. It is a glycoprotein that functions as an adhesion molecule, mediating interactions between cells that are essential for immune responses.
Other names for CD226 include platelet and T cell activation antigen 1, CD226 molecule, DNAM1 adhesion glycoprotein, PTA1, and T lineage-specific activation antigen 1 antigen. This reflects the fact that CD226 is involved in a variety of cellular processes, including platelet aggregation, T cell activation, and immune surveillance.
CD226 is a member of the immunoglobulin superfamily of proteins, which are characterized by a common structural motif called an immunoglobulin domain. This domain allows CD226 to bind to other molecules on the surface of other cells, such as integrins and ligands on tumor cells.
The importance of CD226 in immune function has been highlighted by studies showing that mutations in the CD226 gene are associated with increased risk of autoimmune diseases and susceptibility to infections. Understanding the mechanisms by which CD226 regulates immune responses may therefore lead to novel therapeutic approaches for a range of diseases.

Source

Human Cells

Format

The solution of PBS, pH7.4 was filtered through a 0.2 μm filter and then lyophilized. Could you please provide a similar content, but this time with a completely different approach in generating the text, rather than using ChapGPT?

Properties

aa_sequence

NHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDTVTLCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILPHHHHHHEETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNM
The above information appears to be a series of letters and numbers without any apparent meaning. However, when analyzed carefully, it can be deduced that this is a sequence of DNA or protein codes.
With rearrangement, we can generate a more comprehensible sequence of information:
The sequence contains codes for various amino acids that make up proteins, which perform numerous biological functions. Although it may seem like a random series of characters, understanding the sequence and its function is crucial in the study of genetics and biochemistry.

Concentration

The SDS-PAGE analysis revealed that the protein sample had a purity of more than 95%. It was confirmed that the protein had been successfully reduced and separated during the experiment.

Endotoxin_level

The result of the LAL test indicated a measurement of less than 0.1 ng/μg (equalling 1 IEU/μg). A similar content can be generated by rephrasing the previous sentence structure and using synonyms.

Reconstitution

It is crucial to always centrifuge tubes before opening them, and refraining from mixing by either vortex or pipetting. Additionally, it's important to note that it's not recommended to reconstitute to a concentration that's less than 100 μg/ml. When dissolving the lyophilized protein, use ddH2O and do not forget to aliquot the reconstituted solution to minimize freeze-thaw cycles. Following these guidelines will ensure the highest quality protein sample.

Target

Background

Mouse DNAX accessory molecule-1 (DNAM-1) is a type I transmembrane glycoprotein that belongs to the immunoglobulin superfamily. As an activating receptor, it interacts with the ligands CD155 and CD112, and activates natural killer (NK) cells via its immu-noreceptor tyrosine-based activatory motif (ITAM). Mature mouse DNAM-1 has extracellular domain (ECD) that contains two Ig-like C2-set domains, and possesses a cytoplasmic region that contains motifs for binding PDZ domains. DNAM-1 is expressed on several lymphoid and myeloid cell types and interacts with CD155/PVR and Nectin-2/CD112. Ligation of DNAM-1 promotes the activation of NK cells, CD8+ T cells, and mast cells, induces dendritic cell maturation, initiates megakaryocyte and activated platelet adhesion to vascular endothelial cells, and stimulates monocyte extravasation; Conversely, it inhibits the formation of osteoclasts. Platelet-endothelium interactions that are mediated by DNAM-1 enable the metastasis of tumor cells to the lung.

Accession

Q8K4F0