
Recombinant Mouse Platelet Receptor Gi24/VISTA/B7-H5 (C-6His) #abs04569
Please note that the price mentioned above is only for your reference. For more details on the pricing, kindly get in touch with our sales representative Vecent. Kindly note that the content generated is meant to convey the same information as the original text but using different language model...
Description
Catalog-specification | Delivery time | USD price |
abs04569-10ug | 1-2 Weeks | 146 |
abs04569-50ug | 1-2 Weeks | 382 |
abs04569-500ug | 1-2 Weeks | 2353 |
abs04569-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is only for your reference. For more details on the pricing, kindly get in touch with our sales representative Vecent. Kindly note that the content generated is meant to convey the same information as the original text but using different language model techniques.
Overview | |
Description | Our Mammalian expression system has successfully generated Recombinant Mouse Platelet receptor Gi24. The target gene encoding Phe33-Ala191 has been expressed with a 6His tag at the C-terminus, resulting in a highly purified protein. This protein is structurally similar to the original protein and is expected to function similarly in various biological assays. We are proud of our efficient expression system and the quality of our product. |
Other names | The protein known as GI24 or Platelet Receptor Gi24, is also referred to by several other names, such as Stress-Induced Secreted Protein 1 (SISP1), Dies1, and B7-H5. Another name associated with this protein is VISTA or PD-1H. Despite the multiple names, the function of this protein is relatively unknown and still being explored. However, recent research has suggested that GI24 may play an important role in immune regulation and cancer development. |
Source | Human Cells |
Format | The material was dehydrated by freeze-drying after filtration through a 0.2 μm filter in phosphate-buffered saline at pH 7.4. |
Properties | |
aa_sequence | VEYTCGADSDYRPSQNPECMKRNIFSGLVYQTLKTTSHPKLHGSGNACLTIQPVRTWSHHGDVQ KKELMNYPTHIASDFLYVSQTVGIQELLGRTPQHSFRTNGGVYSSSEVTNKRYTCGSAHSIPFEQ GENCLVYCGSHEDAFNTPSHKIYHTLKQHVPGQPMCQRGPVEVLYSRVGIQSKKVNQMLKFSDT |
Concentration | The level of purity was found to be over 95% by conducting SDS-PAGE analysis. To create similar content, the following text could be generated: Upon conducting an analysis using SDS-PAGE, it was determined that the purity level was greater than 95%. |
Endotoxin_level | The LAL test determined that the content is below 0.1 ng/μg (1 IEU/μg) in concentration. Let's generate a rearranged version of the original information while ensuring its similarity. |
Reconstitution | Before opening, it is important to always centrifuge the tubes. Avoid mixing by vortex or pipetting. It is strongly advised not to reconstitute the protein at a concentration lower than 100 μg/ml. Ensure complete dissolution of the lyophilized protein by using ddH2O. To prevent damage from freeze-thaw cycles, it is recommended to aliquot the reconstituted solution. Please rearrange the provided information to create a distinct content, as opposed to generating text using ChapGPT. |
Target | |
Background | Mouse Platelet receptor Gi24 (VISTA) is a transmembrane glycoprotein with homology to B7like immune costimulatory molecules. Mature mouse Gi24 contains a 159 amino acid (aa) extracellular domain (ECD) with one V-type Ig-like domain, a 21 aa transmembrane segment, and a 97 aa cytoplasmic domain. VISTA promotes both MT1-MMP expression and the MT1-MMP mediated activation of MMP-2. It supports the differentiation of embryonic stem cells (ESC) and enhances BMP-4 induced signaling in ESC, but it is also down-regulated following BMP-4 exposure. It binds to BMP-4 directly and also associates with the type I BMP receptor Activin RIB/ALK-4. It is expressed on the surface of naïve CD4+ T cells and regulatory T cells. It is up-regulated in vivo on activated monocytes and dendritic cells. VISTA inhibits CD4+ and CD8+ T cell proliferation and their production of IL-2 and IFN-γ. Its expression on tumor cells attenuates the antitumor immune response and enables more rapid tumor progression. |
Accession | Q9D659 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant mouse platelet receptor gi24/vista/b7-h5 (c-6his) #abs04569, China recombinant mouse platelet receptor gi24/vista/b7-h5 (c-6his) #abs04569 suppliers
Send Inquiry
You Might Also Like






