
Recombinant Human Signal-Regulatory Protein γ/SIRPG/CD172g (C-Fc) #abs04415
Please note that the price provided is for reference only. For specific and detailed pricing, please contact our seller Vecent. It is important to emphasize that our prices may vary depending on various factors and our seller will provide you with all the necessary information you need....
Description
Catalog-specification | Delivery time | USD price |
abs04415-10ug | 1-2 Weeks | 146 |
abs04415-50ug | 1-2 Weeks | 382 |
abs04415-500ug | 1-2 Weeks | 2353 |
abs04415-1mg | 1-2 Weeks | 3201 |
Please note that the price provided is for reference only. For specific and detailed pricing, please contact our seller Vecent. It is important to emphasize that our prices may vary depending on various factors and our seller will provide you with all the necessary information you need. Therefore, do not hesitate to reach out to Vecent for any additional inquiries or clarifications.
Overview | |
Description | Our Mammalian expression system is responsible for the production of Recombinant Human Signal-Regulatory Protein gamma. This protein is encoded by the target gene Glu29-Pro360, and it is expressed with a Fc tag at the C-terminus. |
Other names | CD172 Antigen-Like Family Member B, also known as Signal-Regulatory Protein Gamma (SIRP-Gamma), Signal-Fegulatory Protein Beta-2 (SIRP-Beta-2), CD172g, SIRPG, or SIRP-B2, is a cell surface molecule that plays a crucial role in modulating immune responses. It belongs to the SIRP family of proteins that are known for their interaction with the tyrosine phosphatase, SHP-1. |
Source | Human Cells |
Format | The material has been dried by lyophilization from a solution of PBS with a pH of 7.4, which has been filtered through a 0.2 μm filter. |
Properties | |
aa_sequence | VVKTDPTTVRPFHGEKQNYILEGRPVGWLPVLLSTVTHCLTATAKGTVLLEKQPEQEMIQLELQEEQ ILSPSNITVGYCKVSAAEINTGTKEFKGDAPLGAPSVPAKPAGLLTVGLPVARTAPEFTVSHTPE RSDVQTLKRNDFAISNMISIPTSYCVYENKVAEFGGSKTLEMAKPGATEPVGPVPALRTLSCLVP QSSQVVIWFRNKDNLTSDTGQDPVSNVTRYSSIVLVAPDVQSRVVRFEAQDGPCMQIAEANLLAQ TKVRVAQMSLQEGNVCLHGYNTSAMLSGTAKNLECVALYAVRKLSQLEHVSATTDSPSADDVREG KCPCTCPPPHLLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEEPEVKFNWYVDGVEVHNAR TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNAKPAPIEKTISKAKGQPREPQVYTLPPSR EMKTNQVSLTCLVKGFYPSDIAVEWDSNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGKELVTQDGRIRPQNGNVFSCSVMHEGLHNHYTQKSLSLS |
Concentration | The purity of the sample was found to be more than 95% through SDS-PAGE analysis. Can you please provide me with an alternative text that conveys the same information but in a different way, using language modeling techniques as opposed to the ChapGPT approach? |
Endotoxin_level | The LAL test determined that the value is below 0.1 ng/μg (1 IEU/μg). Please rearrange the content to generate highly similar information, while ensuring it is based on the same original text. |
Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Target | |
Background | Signal-Regulatory Protein Gamma (SIRPG) is a member of the signal-regulatory protein (SIRP) family and also belongs to the immunoglobulin superfamily. SIRPG is detected in the liver, and at very low levels in the brain, heart, lung, pancreas, kidney, placenta, and skeletal muscle. SIRPG is an immunoglobulin-like cell surface receptor. On binding with CD47, SIRPG mediates cell-cell adhesion. Engagement on T-cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell activation. SIRPG as receptor-type transmembrane glycoproteins is involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. |
Accession | Q9P1W8 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human signal-regulatory protein γ/sirpg/cd172g (c-fc) #abs04415, China recombinant human signal-regulatory protein γ/sirpg/cd172g (c-fc) #abs04415 suppliers
Send Inquiry
You Might Also Like






