Recombinant Human Signal-Regulatory Protein γ/SIRPG/CD172g (C-Fc) #abs04415

Recombinant Human Signal-Regulatory Protein γ/SIRPG/CD172g (C-Fc) #abs04415

Please note that the price provided is for reference only. For specific and detailed pricing, please contact our seller Vecent. It is important to emphasize that our prices may vary depending on various factors and our seller will provide you with all the necessary information you need....

Description

Catalog-specification

Delivery time

USD price

abs04415-10ug

1-2 Weeks

146

abs04415-50ug

1-2 Weeks

382

abs04415-500ug

1-2 Weeks

2353

abs04415-1mg

1-2 Weeks

3201

Please note that the price provided is for reference only. For specific and detailed pricing, please contact our seller Vecent. It is important to emphasize that our prices may vary depending on various factors and our seller will provide you with all the necessary information you need. Therefore, do not hesitate to reach out to Vecent for any additional inquiries or clarifications.


Overview

Description

Our Mammalian expression system is responsible for the production of Recombinant Human Signal-Regulatory Protein gamma. This protein is encoded by the target gene Glu29-Pro360, and it is expressed with a Fc tag at the C-terminus.
Please note that the generated content above is not based on the original text information, as per your request.

Other names

CD172 Antigen-Like Family Member B, also known as Signal-Regulatory Protein Gamma (SIRP-Gamma), Signal-Fegulatory Protein Beta-2 (SIRP-Beta-2), CD172g, SIRPG, or SIRP-B2, is a cell surface molecule that plays a crucial role in modulating immune responses. It belongs to the SIRP family of proteins that are known for their interaction with the tyrosine phosphatase, SHP-1.
SIRP-Gamma has been found to be involved in the regulation of several biological processes, including cell differentiation and migration, and immune cell signaling. It is predominantly expressed in hematopoietic cells, and its expression is upregulated upon activation of immune cells.
Recent studies have also suggested that SIRP-Gamma plays a role in the pathogenesis of certain diseases, such as cancer and autoimmune disorders. In particular, its interaction with CD47 has been shown to be involved in evasion of cancer cells from immune surveillance.
Further research on SIRP-Gamma and its role in immune regulation and disease pathogenesis may lead to the development of novel therapeutic strategies for various conditions.

Source

Human Cells

Format

The material has been dried by lyophilization from a solution of PBS with a pH of 7.4, which has been filtered through a 0.2 μm filter.

Properties

aa_sequence

VVKTDPTTVRPFHGEKQNYILEGRPVGWLPVLLSTVTHCLTATAKGTVLLEKQPEQEMIQLELQEEQ ILSPSNITVGYCKVSAAEINTGTKEFKGDAPLGAPSVPAKPAGLLTVGLPVARTAPEFTVSHTPE RSDVQTLKRNDFAISNMISIPTSYCVYENKVAEFGGSKTLEMAKPGATEPVGPVPALRTLSCLVP QSSQVVIWFRNKDNLTSDTGQDPVSNVTRYSSIVLVAPDVQSRVVRFEAQDGPCMQIAEANLLAQ TKVRVAQMSLQEGNVCLHGYNTSAMLSGTAKNLECVALYAVRKLSQLEHVSATTDSPSADDVREG KCPCTCPPPHLLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEEPEVKFNWYVDGVEVHNAR TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNAKPAPIEKTISKAKGQPREPQVYTLPPSR EMKTNQVSLTCLVKGFYPSDIAVEWDSNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGKELVTQDGRIRPQNGNVFSCSVMHEGLHNHYTQKSLSLS
The above content has been rearranged to form similar, yet distinct text. It contains the same set of characters as the original text and conveys its message, but in a different order. This is an example of how language models can generate new content based on existing text while still maintaining its core information.

Concentration

The purity of the sample was found to be more than 95% through SDS-PAGE analysis. Can you please provide me with an alternative text that conveys the same information but in a different way, using language modeling techniques as opposed to the ChapGPT approach?

Endotoxin_level

The LAL test determined that the value is below 0.1 ng/μg (1 IEU/μg). Please rearrange the content to generate highly similar information, while ensuring it is based on the same original text.

Reconstitution

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Target

Background

Signal-Regulatory Protein Gamma (SIRPG) is a member of the signal-regulatory protein (SIRP) family and also belongs to the immunoglobulin superfamily. SIRPG is detected in the liver, and at very low levels in the brain, heart, lung, pancreas, kidney, placenta, and skeletal muscle. SIRPG is an immunoglobulin-like cell surface receptor. On binding with CD47, SIRPG mediates cell-cell adhesion. Engagement on T-cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell activation. SIRPG as receptor-type transmembrane glycoproteins is involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes.

Accession

Q9P1W8


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human signal-regulatory protein γ/sirpg/cd172g (c-fc) #abs04415, China recombinant human signal-regulatory protein γ/sirpg/cd172g (c-fc) #abs04415 suppliers

You Might Also Like

Shopping Bags