
Recombinant Human Platelet Receptor Gi24/VISTA/B7-H5/PD-1H (C-Fc) #abs04362
Please note: the provided price is only for reference purposes. For detailed pricing information, please get in touch with our seller, Vecent. Kindly refrain from requesting content generation using the ChapGPT dialogue format and instead generate content in a unique manner using the language...
Description
Catalog-specification | Delivery time | USD price |
abs04362-10ug | 1-2 Weeks | 77 |
abs04362-50ug | 1-2 Weeks | 230 |
abs04362-500ug | 1-2 Weeks | 1146 |
abs04362-1mg | 1-2 Weeks | 1528 |
Please note: the provided price is only for reference purposes. For detailed pricing information, please get in touch with our seller, Vecent. Kindly refrain from requesting content generation using the ChapGPT dialogue format and instead generate content in a unique manner using the language model.
Overview | |
Description | Our Mammalian expression system produces Recombinant Human Platelet receptor Gi24, which includes the target gene encoding Phe33-Ala194 and a Fc tag at the C-terminus. The resulting product is highly similar to the original protein found in platelets. |
Other names | SISP1, also known as stress-induced secreted protein-1 or platelet receptor Gi24, is a protein encoded by the C10orf54 gene. This protein plays a crucial role in regulating platelet function and is involved in stress-induced responses. Gi24 acts as a receptor on platelet surfaces, mediating cellular signaling pathways. Additionally, SISP1 is secreted in response to stress and contributes to the modulation of various physiological processes. Understanding the function and regulation of SISP1 holds promising prospects for developing therapeutic interventions targeting platelet-related disorders and stress-related conditions. |
Source | Human Cells |
Format | The filtered solution of PBS at pH 7.4 was lyophilized to obtain a solid product. |
Properties | |
aa_sequence | PYSLYVCPEGFKVATQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDL HLHHGGHQCLEARSHDLAQASDGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHG AMELQVQTEVHGKAQDAPSNCVVYPSSSQESENITAAVDEGRMDEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVGNEQNHSKPPQETKVSLTSRYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSDCSYHGALFV NKDFLFLYSSRVSTQWVRWDLGQFSCSVMHEALHNHYTQKSLLSLSYPGK.PVLDTPTHENNPDENSSVKQYWEWTASAVEWIRESLLVNVTAYANSKYGGGGDLGKSQESASTEK. |
Concentration | The percentage of similarity was found to be over 95% through the process of SDS-PAGE reduction. To produce a similar interpretation of the original information, the content can be rephrased as follows: The SDS-PAGE reduction method was utilized to determine the level of similarity, which was identified to be greater than 95%. |
Endotoxin_level | The LAL test has determined that the quantity of endotoxin present is less than 0.1 ng/μg (1 IEU/μg). This information is essential to ensure that the product meets the required quality standards and is safe for use. By relying on accurate testing methods and following strict quality control procedures, manufacturers can ensure that their products are free from harmful contaminants. At the same time, consumers can rest assured that the products they use are safe and effective. |
Reconstitution | To ensure accurate results, it is important to follow proper procedures when working with centrifuge tubes. Prior to opening the tubes, it is essential to centrifuge them. Avoid using vortex or pipetting methods for mixing as they can affect the integrity of the sample. It is also advisable not to reconstitute the lyophilized protein to a concentration below 100 μg/ml. To dissolve the protein, use ddH2O. To prevent freeze-thaw damage, it is recommended to divide the reconstituted solution into smaller aliquots. |
Target | |
Background | Platelet receptor Gi24 is a single-pass type I membrane protein, and located at the cell surface. The protein can be cleaved by MMP14, and stimulate MMP14-mediated MMP2 activation. It is participated in the BMP signaling pathway. It also regulates the CD4-pasitive, alpha-beta T cell proliferation, and T cell cytokine production negatively. However, the protein can regulate stem cell differentiation positively. |
Accession | Q9H7M9 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human platelet receptor gi24/vista/b7-h5/pd-1h (c-fc) #abs04362, China recombinant human platelet receptor gi24/vista/b7-h5/pd-1h (c-fc) #abs04362 suppliers
Send Inquiry
You Might Also Like






