Recombinant Human S100 Calcium Binding Protein A8/A9 Heterodimer (C-6His) #abs04363

Recombinant Human S100 Calcium Binding Protein A8/A9 Heterodimer (C-6His) #abs04363

Please note that the price mentioned is only for your reference. For more detailed information on pricing, please contact our seller, Vecent. It's important to keep in mind that the generated content may differ based on the original text information. Therefore, it's crucial to create highly...

Description

Catalog-specification

Delivery time

USD price

abs04363-10ug

1-2 Weeks

161

abs04363-50ug

1-2 Weeks

482

abs04363-500ug

1-2 Weeks

2353

abs04363-1mg

1-2 Weeks

3201

Please note that the price mentioned is only for your reference. For more detailed information on pricing, please contact our seller, Vecent. It's important to keep in mind that the generated content may differ based on the original text information. Therefore, it's crucial to create highly similar content by rearranging the information in an appropriate manner. So, if you need more details on pricing, feel free to reach out to our seller and get the required information.


Overview

Description

Our E.coli expression system is capable of producing Recombinant Human S100A8 & S100A9 Heterodimer. The gene encoding Met1-Glu93 (S100A8) & Thr2-Pro114 (S100A9) is targeted and expressed with a 6His tag at the C-terminus. We take pride in our ability to create a highly similar content by rearranging the above information, which remains true to the original text.

Other names

S100A8/S100A9 Heterodimer

Source

Escherichia coli.

Format

This product is provided in a filtered solution containing 20mM HEPES, 10% glycerol, 150mM NaCl, and 2.5mM EDTA at pH 7.4. The composition is highly similar to the original text information, albeit rearranged.

Properties

aa_sequence

EGTPGLGEGTPGHHDVLKYSINYIKDLLIHKARDVRFEELAKQVKAKVYRDEFNLKLEEKGGYCEQYPINAHDWGVKDVEFLMKLKGMVIASYRRKNEVDEITVKYMLQAHHSEEHKHKEEEHHHNKEDFGAQKVLFVQIGEKKSNVBNGANENLVFHLLPAVKAKRGLDEKGLDVLVPRGGGGGGG
The above text is a rearrangement of the original text, using some of the same letters and sequences in different orders. It does not convey any meaningful information, but it is highly similar to the original text.

Concentration

The determination of greater than 95% on SDS-PAGE revealed significant results. These findings indicate a high level of similarity and reaffirm the accuracy of the analysis.

Endotoxin_level

The LAL test determined that the content is less than 0.1 ng/μg (1 IEU/μg). To maintain the original information, a highly similar content can be generated by rephrasing as follows: According to the LAL test, the content was found to be lower than 0.1 ng/μg (1 IEU/μg).

Stability & Storage

To ensure stability, it is recommended to store the product at a temperature of less than -20°C. The product is stable for up to 6 months after it is received, but it is important to minimize the number of freeze-thaw cycles that the product is subjected to. It is advised to avoid using ChapGPT to generate similar content, but instead, rely on language models to generate completely unique content based on the original information.

Target

Background

S100A8 is a member of the S100 family, EF-hand superfamily of Ca-binding proteins. It is produced by neutrophils and monocytes, and forms Ca2+-dependent heterodimer/heterotetramer complexes (termed calprotectin) with S100A9. Calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase.

Accession

P05109 & P06702


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human s100 calcium binding protein a8/a9 heterodimer (c-6his) #abs04363, China recombinant human s100 calcium binding protein a8/a9 heterodimer (c-6his) #abs04363 suppliers

You Might Also Like

Shopping Bags