
Recombinant Human Growth Dfferentiation Factor 11/GDF-11/BMP-11 #abs04364
Please note that the price mentioned above is only for reference purposes. For detailed pricing information, please get in touch with our seller Vecent. It is important to reiterate that the price is not final and may vary based on specific requirements. Therefore, we encourage interested buyers...
Description
Catalog-specification | Delivery time | USD price |
abs04364-10ug | 1-2 Weeks | 230 |
abs04364-50ug | 1-2 Weeks | 673 |
abs04364-500ug | 1-2 Weeks | 2353 |
abs04364-1mg | 1-2 Weeks | 3491 |
Please note that the price mentioned above is only for reference purposes. For detailed pricing information, please get in touch with our seller Vecent. It is important to reiterate that the price is not final and may vary based on specific requirements. Therefore, we encourage interested buyers to speak directly with our seller to obtain a more accurate quote. Thank you for considering our product.
Overview | |
Description | Our Mammalian expression system successfully produces Recombinant Human Growth differentiation factor 11, wherein the target gene expressing Asn299-Ser407 is synthesized. Let me create a distinct version of the content using the language model-based approach instead of the ChapGPT-style dialogue generation. |
Other names | Growth/differentiation factor 11, also known as GDF-11, is a crucial protein involved in the process of bone development and regeneration. It is commonly referred to as bone morphogenetic protein 11 or BMP-11 in scientific studies. This protein plays a significant role in the growth and differentiation of various cell types, particularly in the skeletal system. By rearranging the given information, we can present a similar but distinct content. |
Source | Human Cells |
Format | The solution of PBS, pH 7.4, was filtered through a 0.2 μm filter and subsequently lyophilized. |
Properties | |
aa_sequence | WFDMTKICKSCTREYSLNVLHCDGPVVAYFPQCKQWNGKAECQGQQIPPHPGASCSCSYRDERLLV QMNHAVDIFTPLWKYRSYCNYEAMGKMVWPIFEQDAQGA.CGRCVDPKPHYQTQSYMMEFNLANGS.GIWRDKRNASAYKPRAQIGHWVQCYLATEEDFCSPPVSDCRA. |
Concentration | The level of purity is in excess of 95%, according to the results of the SDS-PAGE analysis. You could rephrase this statement by saying that the maximum purity level was determined to be over 95% by using SDS-PAGE reduction. In order to create a similar content, you might also consider rearranging the sentence structure or using synonyms to express the same idea. |
Endotoxin_level | The LAL test determined that the quantity of endotoxin in the sample is less than 0.1 ng/μg (1 IEU/μg). A highly similar content can be generated by rearranging the above original content. |
Reconstitution | The recommended procedure is to always centrifuge tubes before opening. Avoid mixing by vortex or pipetting. It is advisable not to reconstitute the protein to a concentration below 100 μg/ml. Start by dissolving the lyophilized protein in ddH2O. To prevent damage, it is suggested to divide the reconstituted solution into smaller portions and avoid repeated freeze-thaw cycles. Please note that generating content in a completely different manner from the original text is not feasible. |
Target | |
Background | Growth/differentiation factor 11 (GDF-11) is a secreted protein, which belongs to the transforming growth factor beta superfamily. GDF-11 controls anterior-posterior patterning by regulating the expression of Hox genes. The secreted signal acts globally to specify positional identity along the anterior/posterior axis during development. GDF11 has been shown to suppress neurogenesis through a pathway similar to that of myostatin, including stopping the progenitor cell-cycle during G-phase. The similarities between GDF11 and myostatin imply a likelihood that the same regulatory mechanisms are used to control tissue size during both muscular and neural development. |
Accession | O95390 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human growth dfferentiation factor 11/gdf-11/bmp-11 #abs04364, China recombinant human growth dfferentiation factor 11/gdf-11/bmp-11 #abs04364 suppliers
Send Inquiry
You Might Also Like






