Recombinant Human Ubiquitin-Conjugating Enzyme E2 Z/UBE2Z (N-6His) #abs04418

Recombinant Human Ubiquitin-Conjugating Enzyme E2 Z/UBE2Z (N-6His) #abs04418

Please note that the price mentioned above is for reference only. For the exact price, kindly get in touch with our seller Vecent. It is important to emphasize that the content must reflect the same information as the original text, using different grammar and vocabulary structures to ensure a...

Description

Catalog-specification

Delivery time

USD price

abs04418-10ug

1-2 Weeks

77

abs04418-50ug

1-2 Weeks

153

abs04418-500ug

1-2 Weeks

535

abs04418-1mg

1-2 Weeks

1528

Please note that the price mentioned above is for reference only. For the exact price, kindly get in touch with our seller Vecent. It is important to emphasize that the content must reflect the same information as the original text, using different grammar and vocabulary structures to ensure a highly similar outcome.


Overview

Description

Our E.coli expression system is responsible for manufacturing Recombinant Human Ubiquitin-Conjugating Enzyme E2 Z, which is a protein encoded by the target gene ranging from Met1 to Val246. The protein is associated with a 6His tag at the N-terminus.

Other names

Uba6-Specific E2 Conjugating Enzyme 1, also known as Ubiquitin-Conjugating Enzyme E2 Z, is an essential protein in the ubiquitination pathway. Use1 is another name for this protein. Use1 plays a critical role in mediating the transfer of ubiquitin from ubiquitin-conjugating enzyme E1 to the target protein. It is also involved in the degradation of damaged and misfolded proteins. A deficiency in UBE2Z can lead to several diseases, including cancer and neurodegenerative disorders. Thus, UBE2Z is a promising target for therapeutic interventions. HOYS7 and Ubiquitin Carrier Protein Z also refer to this critical protein. Overall, UBE2Z is an important protein in the ubiquitination pathway that plays a vital role in maintaining cellular homeostasis.

Source

Escherichia coli.

Format

The solution provided is filtered with a 0.2 μm filter and contains 50mM HEPES and 50mM NaCl, with a pH level of 8.0. Can you produce a similar content using the original information but in different words without relying on ChapGPT?

Properties

aa_sequence

GSHSSMGVPPSHMSSHYHLIVIGTPRGPDFFGPMKDTMXPIEKPVPFSHFIVFLVVCMPRVTTNTNLSSSVCWIISMLMIQEGTEMREFRHMLMFMTVYNMTYLFGPYRHPRGQRSRLESKNDRCYEDSRVTGTPDDRCHALVVCKVPKLSYIQGMEGDPQYDDMEPYLWKFSLYPMPRSSQGELRENAHYYEHTQGELRKGGMKCVILRIWSTADVTWLGGFISPEQIHNCSRSHNNGLMDLHDSGMISS.TSLVTHGVVVPDSGMVPKKTERPYFIFEQKGTHYQMYDPDRFRQMLSNLQGLRINQEVCDMEEPKCPCEAMEGFVYDFLVMHGYQDHHISTRQEMLDLNEDG.

Concentration

SDS-PAGE,95%。

Endotoxin_level

The LAL test has indicated levels less than 0.1 ng/μg (1 IEU/μg) in the product. It is important to ensure that similar levels are maintained in order to meet the required standards.

Stability & Storage

To preserve the quality of this product, it must be stored at a temperature below -20°C. It will remain stable for up to six months after it has been received, but it is important to avoid repeated freeze-thaw cycles. Please ensure that the product is handled with care to prevent any potential damage.

Target

Background

Ubiquitin-Conjugating Enzyme E2 Z (ZUBE2Z) is a member of the E2 ubiquitin-conjugating enzyme family. ZUBE2Z is widely expressed in many tissues, with high expression found in the placenta, pancreas, spleen, and testis. It is ubiquitinates proteins that catalyze the covalent attachment of ubiquitin to other proteins. It has shown that ZUBE2Z participate in signaling pathways, and may be involved in apoptosis regulation.

Accession

Q9H832-2


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human ubiquitin-conjugating enzyme e2 z/ube2z (n-6his) #abs04418, China recombinant human ubiquitin-conjugating enzyme e2 z/ube2z (n-6his) #abs04418 suppliers

You Might Also Like

Shopping Bags