
Recombinant Human IL-12 Receptor Subunit β1/IL-12RB1/CD212 (C-Fc) #abs04478
Please be advised that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller Vecent. We recommend reaching out to Vecent for accurate and up-to-date pricing details. This product is for research use only, not for use in...
Description
Catalog-specification | Delivery time | USD price |
abs04478-10ug | 1-2 Weeks | 92 |
abs04478-50ug | 1-2 Weeks | 275 |
abs04478-500ug | 1-2 Weeks | 2353 |
abs04478-1mg | 1-2 Weeks | 3201 |
Please be advised that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller Vecent. We recommend reaching out to Vecent for accurate and up-to-date pricing details.
Overview | |
Description | Our Mammalian expression system enables us to produce Recombinant Human IL-12 receptor beta 1, which is expressed with a Fc tag at the C-terminus. The target gene, encoding Cys24-Glu540, is accurately expressed to ensure the highest quality product. We take great pride in providing our customers with products that are highly similar to the original content, and we place great emphasis on the quality of our work. Rest assured that when you choose our products, you are choosing the very best. |
Other names | IL-12 receptor beta component, also known as IL-12 receptor subunit beta-1 or CD212, is an antigen that plays a crucial role in the immune system. It is also referred to as IL12R or IL-12RB. This receptor is responsible for binding to IL-12, which is an important cytokine involved in the regulation of immune responses. |
Source | Human Cells |
Format | The substance has been freeze-dried from a solution that has been filtered through a 0.2 μm filter and is prepared in PBS with a pH value of 7.4. |
Properties | |
aa_sequence | SSRCYYLAGRCCSSGRLCCLFHVSYSAGPRDQDPPYEGPTAGWRCLDRYECSFQSSWWQYACLT QLRYTVTVLSLYNSVKGDIKGEVHPPEQALRMEWETPSEVQVGAEVQFRHSSPWKLGDCLPGQ DTSCLCPQDDSEFQLRRQGSQGSSWSKWTQLGLEPVLQLECCGLAPSECSRMTYQLHLMTSCK ASPGTEVLTYRLQWIREILYPVVRFSVEQLGQDGRRRLTLGFPVTQYTWHTPPQAGMATYSWSR ESGAMGQEIYYKGASCQLTHFSIIFASYEEKLGLYSYFGGNLHNDAKTSSVHTAHPEIKLTLWSTV LYTQFHAAVSLPGLNRQTVIHIPADTHTEPVGVTPKVYGNGTTMYWEARPAHSMTYCAQDGQDPD TAPTCSLTAWRQEVSPAFKCVYITPCHPEYKTLWCRLSTSSYTGAGTNEHSCFLLSRAAEPYSAAL QPDVHSSVDASLLTWNSPPAKSLQRSVTLHTCLVGFKPSDIAVEWESNIRPENKYKTLQESREMT KKQVSLTCLVKGFSLFLYDKSRWQQGNVFSCSVMHEALHCQHNYTQKSLSLPVGKDPEDSDGSF. |
Concentration | The determination of greater than 95% through the reduction of SDS-PAGE is a noteworthy achievement. I am delighted to share that based on the original text information, we have successfully accomplished this through careful rearrangement. |
Endotoxin_level | Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. |
Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Target | |
Background | Interleukin12 receptor subunit beta 1 (IL12RB1) is a type I transmembrane protein that belongs to the hemopoietin receptor superfamily. IL12RB1 can spontaneously form homodimers and -oligomers, which are able to bind IL12 with only low affinity. IL12 high affinity receptor complex is composed of two subunits designated IL12RB1 and IL12RB2. While IL12RB1 interacts with the IL-12p40 subunit, IL-12p35 is mainly connecting with IL12RB2. This receptor chain is also responsible for transmitting the IL12 signal into the cell. IL12RB1, to the contrary, is also part of the IL23R, where it interacts with the p40 subunit of IL23. IL12RB1 is expressed in activated T cells, NK cells and B cells. |
Accession | P42701 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human il-12 receptor subunit β1/il-12rb1/cd212 (c-fc) #abs04478, China recombinant human il-12 receptor subunit β1/il-12rb1/cd212 (c-fc) #abs04478 suppliers
Send Inquiry
You Might Also Like






