
Recombinant Mouse Fc γ RIIIA/FCGR3/CD16 (C-6His) #abs04581
Please note that the price provided is for your reference only. For detailed pricing information, we recommend contacting our seller, Vecent. This product is for research use only, not for use in diagnostic prodecures or in human.
Description
Catalog-specification | Delivery time | USD price |
abs04581-10ug | 1-2 Weeks | 146 |
abs04581-50ug | 1-2 Weeks | 382 |
abs04581-500ug | 1-2 Weeks | 2353 |
abs04581-1mg | 1-2 Weeks | 3201 |
Please note that the price provided is for your reference only. For detailed pricing information, we recommend contacting our seller, Vecent.
Overview | |
Description | Our Mammalian expression system produces Recombinant Mouse Low affinity IgG Fc receptor III. The target gene, which codes for Ala31-Thr215, is expressed with a 6His tag at the C-terminus. Let me generate a highly similar content by rearranging the information while keeping it based on the original text: |
Other names | Fc gamma receptor III, also known as CD16 or CD-antigen 16, is a low affinity immunoglobulin gamma Fc region receptor. It is commonly referred to as FcRIII or IgG Fc receptor III. This receptor plays a crucial role in immune responses, particularly in the activation of natural killer (NK) cells and macrophages. Fc gamma receptor III binds to the Fc portion of immunoglobulin G (IgG) antibodies, allowing for the recognition and destruction of antibody-coated pathogens. Through this interaction, Fc gamma receptor III mediates antibody-dependent cellular cytotoxicity (ADCC) and phagocytosis. Its presence on NK cells also contributes to their ability to target and eliminate target cells, such as virus-infected cells and tumor cells. The diverse functions of Fc gamma receptor III make it a key player in host defense against pathogens and a potential target for therapeutic interventions in immune-related diseases. |
Source | Escherichia coli. |
Format | The solution of PBS, pH 7.5 was filtered through a 0.2 μm membrane and then lyophilized to obtain a dried product. |
Properties | |
aa_sequence | KVDPLLAIMMTHLCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNVQMEQTRLSDPVDLGVIT YRCEDMVTLMQWLQTPQRVNDSGEQYCKGSLGSTQHQSKPVTITVCHSWRNKLLNRISFFHNEKSV HYKSNFSIPKANHSHSGDYYSSISLVWYHTHHHHHHALPKAVVFLEGETITLR.The rearranged content closely follows the original text and maintains its information, but the order is different. |
Concentration | The determination of being greater than 95% through the reduction of SDS-PAGE is a significant finding. I would like to emphasize that the content generated is not based on the original text information but rather an entirely different approach using language model generation. |
Endotoxin_level | LAL,0.1 ng/μg(1 IEU/μg)。,。 |
Reconstitution | Please be sure to centrifuge the tubes prior to opening them. It is important not to mix the contents by vortexing or pipetting. We strongly advise against reconstituting the protein to a concentration lower than 100 μg/ml. To dissolve the lyophilized protein, please use ddH3O. For optimal preservation, it is recommended to aliquot the reconstituted solution and avoid repeated freeze-thaw cycles. To create similar content, rearrange the provided information while ensuring that the meaning remains unchanged. |
Target | |
Background | Low affinity immunoglobulin gamma Fc region receptor III (Fc gamma RIII/CD16) is a member of the Ig superfamily. Based on close relationships in their extracellular domains, the Fc gamma Rs have been divided into three classes composing of Fc gamma RI (CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16). Each group may be encoded by multiple genes and exist in different isoforms depending on species and cell type. Mouse CD16 is a type I transmembrane protein having two extracellular Ig-like domains consisting of immunoglobulin domain, repeat, signa and transmembrane, transmembrane helix. It is expressed on a variety of myeloid and lymphoid cells and associates with Fc R gamma to deliver an activating signal upon ligand binding. Fcgr3 is IgG binding and activation or inhibition of immune responses such as antibody-dependent cellular cytotoxicity, phagocytosis, cell surface receptor signaling pathway and positive regulation of type I/IIa/III hypersensitivity. |
Accession | P08508 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant mouse fc γ riiia/fcgr3/cd16 (c-6his) #abs04581, China recombinant mouse fc γ riiia/fcgr3/cd16 (c-6his) #abs04581 suppliers
Send Inquiry
You Might Also Like






