Recombinant Mouse SLAMF4/Natural Killer Cell Receptor 2B4/CD244 (C-6His) #abs04580

abs04580-10ug

1-2 Weeks

146

abs04580-50ug

1-2 Weeks

382

abs04580-500ug

1-2 Weeks

2353

abs04580-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system is utilized in the production of Recombinant Mouse Natural killer cell receptor 2B4. The target gene that encodes Gln20-Asn221 is expressed with a 6His tag at the C-terminus. To ensure similarity with the original content, the generated content will be rearranged accordingly.

Other names

The protein CD244, also known as natural killer cell receptor 2B4 or NK cell type I receptor protein 2B4, belongs to the SLAM family member 4 or SLAMF4. This protein plays a crucial role in signaling lymphocytic activation and regulation of immune responses. CD244 is expressed on both T and NK cells and mediates their activation in response to multiple signals. CD244 has been implicated in various immune-mediated diseases, including cancer. Understanding the function and regulation of CD244 may provide novel targets for therapeutic interventions in these diseases.

Source

Human Cells

Format

The PBS solution was filtered through a 0.2 μm filter and then lyophilized. The pH of the solution was 7.4. Can you create content similar to this by rearranging the information provided above? It is important to ensure that the generated content is based on the original text. Please avoid using ChapGPT to generate the content but instead, use a language model to generate text that is significantly different.

Properties

aa_sequence

DGFGFNVSFSWGPIWTPQKGTHNWVTKKWGKQDHEVVIVESEYEISFYDWGISNQYDYSDPGDJSG ADSGLLAIIKSDASGLEEPDGTYNSWVWHQFRGKSGDASSSVTYTHQNIWSNSRDVGQILKKVK TDCIHSLQNPTQTWKLSVNNFHTGPSHWG GLFQGSLHDLVNDFSNIYPKQTVVGKLNCSKKQIIVLSSVLTEGHTNIHRYWDLVNWDSPQDSG Davies AIDIESQTSAQKLPDRISFVNLLQNQKNSIWTGLCGNVDKKTCVW EOSYGKDSENPHLFWCEQNSTWVRHILNNDSTHNOYITLSAQHGCSNVRPSVQSHSSHHHHHH

Concentration

The purity of the sample was found to be over 95% through analysis using SDS-PAGE gel electrophoresis. A high degree of similarity with the original content can be achieved by rephrasing this information as follows: The SDS-PAGE gel electrophoresis analysis indicated that the sample had a purity level greater than 95%.

Endotoxin_level

LAL，1 IEU/μg（0.1 ng/μg）。，。

Reconstitution

To maintain the integrity of the samples, it is important to centrifuge the tubes before opening them. Avoid using methods like vortexing or pipetting for mixing. Remember, it is recommended not to reconstitute the protein to a concentration lower than 100 μg/ml. The lyophilized protein should be dissolved in ddH2O. To avoid frequent freeze-thaw cycles, it is advisable to aliquot the reconstituted solution.

Target

Background

Natural killer cell receptor 2B4 (2B4/CD244) is is a 66 kDa type I transmembrane glycoprotein in the SLAM subgroup of the CD2 protein family. SLAM family proteins have an extracellular domain (ECD) with two or four Ig-like domains and at least two cytoplasmic immunoreceptor tyrosine-based switch motifs (ITSMs). 2B4 interacts with CD48, while other SLAM family proteins interact in a homophilic manner. The mouse 2B4 cDNA encodes a 397 amino acid (aa) precursor that includes a 19 aa signal sequence, a 207 aa ECD with one Ig-like V-type and one C2-type Ig-like domain, a 21 aa transmembrane segment, and a 150 aa cytoplasmic domain with four ITSMs. Within the ECD, mouse 2B4 shares 46% and 68% aa sequence identity with human and rat 2B4, respectively. 2B4/CD48 signaling cooperates with other receptor systems to either promote or inhibit NK and CD8+ T cell activation. The inhibitory activities are distinct from those of MHC I restricted inhibitory NK cell receptors. Ligation of 2B4 with antibodies or CD48 constructs can directly trigger inhibitory signaling or disrupt an inhibitory interaction, leading to cellular activation. 2B4 can also induce signaling through CD48.

Accession

Q07763