
Recombinant Human Chitinase-3-Like Protein 1/CHI3L1 (C-6His) #abs04336
Please note that the price mentioned is only for your reference. For detailed pricing information, kindly reach out to our seller, Vecent. We recommend contacting Vecent directly for more precise details regarding the prices. This product is for research use only, not for use in diagnostic...
Description
Catalog-specification | Delivery time | USD price |
abs04336-10ug | 1-2 Weeks | 123 |
abs04336-50ug | 1-2 Weeks | 337 |
abs04336-500ug | 1-2 Weeks | 2353 |
abs04336-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned is only for your reference. For detailed pricing information, kindly reach out to our seller, Vecent. We recommend contacting Vecent directly for more precise details regarding the prices.
Overview | |
Description | Our Mammalian expression system is used to produce Recombinant Human Chitinase-3-Like Protein 1, in which the target gene encoding Tyr22-Thr383 is expressed with a 6His tag at the C-terminus. |
Other names | YKL-40, also known as Chitinase-3-Like Protein 1, is a 39 kDa synovial protein that is also referred to as Cartilage Glycoprotein 39, CGP-39, GP-39, hCGP-39, and CHI3L1. This protein plays a significant role in the pathogenesis of various diseases, including cancer, inflammation, and cardiovascular diseases. The detection of YKL-40 in the body is hence vital in diagnosing and monitoring the progression of these diseases. Additionally, the protein has been shown to be involved in tissue remodeling, cell proliferation, and differentiation. As such, YKL-40 has been identified as a potential therapeutic target for various diseases. Research studies continue to explore the precise mechanisms of YKL-40 in disease pathogenesis, as well as its potential therapeutic applications. |
Source | Human Cells |
Format | After passing through a 0.2 μm filter, a solution containing 20mM PB, 150mM NaCl, and 2mM EDTA at a pH of 7.4 was subjected to lyophilization. This process resulted in the formation of a dry, powdered substance that closely mirrored the composition of the original solution. |
Properties | |
aa_sequence | DRFLCTHIIYSFANISNDHIDTWEWNDVTLYGMLNTLKNRYKLVCYYTSWSQYREGDGSCFPDAL NPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKQHFT GIPGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQL TLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHGAWRGTTHH SPLFRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVGAPISGPAGAMV WALDLDDFQGSFCGQDLRFPLTNAIKDALAATVDHHHHHHGHHSPPlease note, the above generated content follows the original text information but has been rearranged. |
Concentration | The concentration exceeding 95% was established through the application of SDS-PAGE electrophoresis technique. If we exercise a similar methodology, we can generate a content resembling the original text. |
Endotoxin_level | The LAL test has determined that the amount of endotoxin present is under 0.1 ng/μg (equivalent to 1 IEU/μg). To create similar content, the information can be rearranged to state that the LAL test found the endotoxin level to be extremely low at less than 0.1 ng/μg or 1 IEU/μg. |
Reconstitution | The recommended procedure is to always centrifuge tubes before opening them. Avoid using vortex or pipetting techniques for mixing. It is not advisable to dissolve the lyophilized protein in a concentration lower than 100 μg/ml. Use ddH2O to reconstitute the protein. To prevent degradation, it is important to aliquot the reconstituted solution and minimize freeze-thaw cycles. Remember not to engage in conversation using the generated content from ChapGPT, but rather create a completely different speech using the language model. |
Stability & Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Target | |
Background | Chitinase-3-Like Protein 1 (CHI3L1) belongs to the glycosyl hydrolase 18 family. CHI3L1 is expressed in activated macrophages, articular chondrocytes, synovial cells as well as in liver. It lacks chitinase activity and is secreted by activated macrophages, chondrocytes, neutrophils and synovial cells. CHI3L1 is thought to play a role in defense against pathogens, or in tissue remodeling, and in the capacity of cells to respond to and cope with changes in their environment. In addition, CHI3L1 is associated with susceptibility to asthma-related traits type 7 (ASRT7) which assessed by methacholine challenge test, serum IgE levels, atopy, and atopic dermatitis. |
Accession | P36222 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human chitinase-3-like protein 1/chi3l1 (c-6his) #abs04336, China recombinant human chitinase-3-like protein 1/chi3l1 (c-6his) #abs04336 suppliers
Send Inquiry
You Might Also Like






