
Recombinant Mouse Low Affinity IgG Fc Receptor IV/FcgR4/CD16-2 (C-6His) #abs04577
Please note that the price provided is only for reference purposes. If you require more detailed pricing information, please contact our seller Vecent. It is important to reach out to the seller to clarify the exact pricing information before making any decisions. Please make sure to communicate...
Description
Catalog-specification | Delivery time | USD price |
abs04577-10ug | 1-2 Weeks | 146 |
abs04577-50ug | 1-2 Weeks | 382 |
abs04577-500ug | 1-2 Weeks | 2353 |
abs04577-1mg | 1-2 Weeks | 3201 |
Please note that the price provided is only for reference purposes. If you require more detailed pricing information, please contact our seller Vecent. It is important to reach out to the seller to clarify the exact pricing information before making any decisions. Please make sure to communicate with Vecent to get an accurate price quote.
Overview | |
Description | Our Mammalian expression system is responsible for producing Recombinant Mouse Low Affinity Immunoglobulin Gamma Fc Region Receptor IV. The target gene, which encodes Gly21-Gln203, is expressed with a 6His tag at the C-terminus. Please generate a new version of the content by rearranging the given information while maintaining its original meaning. |
Other names | FcgR4, also known as CD16-2 or Low Affinity Immunoglobulin Gamma Fc Region Receptor IV, is an important receptor involved in immune responses. This receptor has a low affinity for immunoglobulin gamma Fc regions. It plays a crucial role in the recognition and binding of antibodies, contributing to the activation of immune cells. FcgR4 is a key player in the immune system and is involved in various immune processes, such as antibody-dependent cell-mediated cytotoxicity and phagocytosis. Understanding the functions and mechanisms of FcgR4 can provide insights into immunotherapy and the development of targeted therapies for immune-related diseases. Overall, FcgR4 is a significant receptor that contributes to the effectiveness of the immune response by facilitating interactions between immune cells and antibodies. |
Source | Human Cells |
Format | The solution was filtered through a 0.2 μm filter and then lyophilized using PBS at a pH of 7.4. Can you please generate a similar passage by rearranging the above text while ensuring that the information remains the same? Please note that the generated content should be different from the original text, generated using the ChapGPT technology. |
Properties | |
aa_sequence | HNDQPVSHGGKYSQNLTVRVKAQDSSQIMFDVWTNERGWCIPHSILHSNVQLAKTSLYIFKDSQ GLCQENSYEDNSIVVRQVPLRPSSFDWKGQTFPERVHSLEWKFNALIQDNPRKVEYLQSETKSV M HYLFSWLGPTPIKRNEQCCSDHLHIQERPWRNVSYYKFVGDGIPDSPGNLKRQCTAKSITHSPlease generate a highly similar content by rearranging the above content, ensuring that the generated content is based on the original text information. |
Concentration | The determination of greater than 95% through SDS-PAGE reduction has been established. Let me now provide you with an alternative content that is distinctly different from the original text. |
Endotoxin_level | According to the results of the LAL test, the level of endotoxin in the sample is less than 0.1 ng/μg (1 International Endotoxin Unit per μg). |
Reconstitution | To ensure proper handling of tubes, always remember to centrifuge them prior to opening. It is crucial not to mix the contents using vortex or pipetting methods. Moreover, it is not advisable to reconstitute the protein to a concentration lower than 100 μg/ml. For dissolving the lyophilized protein, utilize ddH2O. To prevent potential damage, it is suggested to divide the reconstituted solution into smaller portions, minimizing the need for freeze-thaw cycles. |
Target | |
Background | Fcgr4, also known as CD16-2, is one of the receptors for Fc region of IgG which involve in immune responses. Fcgr4 mainly functions in cellular response to lipopolysaccharide, NK T cell proliferation, regulation of sensory perception of pain, wound healing etc. Three groups are included for Fc γ receptors (FcR), and they are Fc γ RI (CD64), Fc γ RII (CD32), and Fc γ RIII (CD16). Among these, CD64 possess high affinity even for monomeric IgG, while CD32 and CD16 display a relative lower affinity for IgG. Genes encodes these receptors are diverse differing by species and cell types. The aggregation of FcR having immunoreceptor tyrosine-based activation motifs (ITAMs) activates sequentially src family tyrosine kinases and syk family tyrosine kinases that connect transduced signals to common activation pathways shared with other receptors. FcR with ITAMs elicit cell activation, endocytosis, and phagocytosis. Fcgr4 belongs to Fc γ RIII (CD16) group. |
Accession | Q8R2R4 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant mouse low affinity igg fc receptor iv/fcgr4/cd16-2 (c-6his) #abs04577, China recombinant mouse low affinity igg fc receptor iv/fcgr4/cd16-2 (c-6his) #abs04577 suppliers
Send Inquiry
You Might Also Like
-

Recombinant Mouse IL-12 Receptor Subunit β2/IL-12RB2...
-

Recombinant Mouse Thymic Stromal Lymphopoietin Recep...
-

Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2...
-

Recombinant Human Jagged-1/JAG1/CD339 (C-Fc) #abs04386
-

Recombinant Human B7-H2/ICOSLG/CD275 (C-6His) #abs04337
-

Recombinant Human BD-1, 47a.a. #abs00946
