Recombinant Human R-Spondin-1/RSPO1 (C-6His) #abs04398

abs04398-10ug

In Stock

161

abs04398-50ug

In Stock

482

abs04398-500ug

In Stock

2353

abs04398-1mg

In Stock

3201

Description

Our Mammalian expression system is responsible for the production of Recombinant Human R-spondin-1. The target gene that encodes Arg31-Ala263 is expressed in this system, with a 6His tag located at the C-terminus.

Other names

Roof plate-specific spondin-1, also known as RSPO1 or R-spondin1, is a protein encoded by the gene RP23-325M14.2 or CRISTIN3. Another name for this protein is FLJ40906. RSPO Rspo1 is a crucial factor in various biological processes. It plays a significant role in embryonic development and tissue homeostasis. The importance of RSPO1 has been demonstrated in various studies, highlighting its impact on cell proliferation, stem cell maintenance, and Wnt signaling pathways. Additionally, it has been linked to the regulation of hair follicle development and female fertility. Understanding the functions of RSPO1 and its various aliases, such as R-spondin or Rspondin, can provide valuable insights into the intricate mechanisms governing developmental and regenerative processes.

Source

Human Cells

MW

26.6kDa

Format

The solution was filtered through a 0.2 μm filter and then lyophilized. The filtered solution was prepared using PBS and had a pH of 7.4.

Properties

aa_sequence

KCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCS RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCI KKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANR NLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPAVDHHHHHH SDSDJASDJIJEEEEEF.

Concentration

Based on the SDS-PAGE analysis, it was found that the protein purity is greater than 95%. This means that the sample underwent a thorough purification process resulting in a highly pure protein. The results are reliable and accurate, providing a strong foundation for further experimentation. The purity level achieved is impressive and showcases the effectiveness of the purification method utilized. With this level of purity, the protein is suitable for a range of applications in the field of biotechnology and beyond. Overall, the SDS-PAGE analysis has provided valuable insights into the quality of the protein sample, and the results suggest that it is of high caliber.

Endotoxin_level

Less than 0.01 EU/μg as determined by LAL test.

Activity

In functional ELISA, Mouse CD36 binding ability was measured. A highly similar content can be generated by rearranging the original text information.

The ED50 for this effectis is less than 100ng/ml.

Reconstitution

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Stability & Storage

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Target

Background

RSPO1 is a secreted protein,containing 2 FU (furin-like) repeats and 1 TSP type-1 domain and belonging to the R-spondin family. RSPO1 is required for the early development of gonads, regardless of sex. It has been found in mice only eleven days after fertilization. To induce cell proliferation, it acts synergistically with WNT4. They help stabilize β catenin, which activates downstream targets. RSPO1 is necessary in female sex development. It augments the WNT/β catenin pathway to oppose male sex development. In critical gonadal stages, between six and nine weeks after fertilization, the ovaries upregulate it while the testes downregulate it. RSPO1 can potentially aid in the treatment of mucositis, which is characterized by inflammation of the oral cavity. This unfortunate condition often accompanies chemotherapy and radiation in cancer patients with head and neck tumors.

Accession

Q2MKA7