
Recombinant Mouse Interleukin-23/IL-23 #abs04583
Please note that the mentioned price is for your reference only. For detailed pricing information, we suggest contacting our seller, Vecent. Please avoid generating content using ChapGPT and instead deliver a speech using a language model that produces distinctly different text. This product is...
Description
Catalog-specification | Delivery time | USD price |
abs04583-10ug | 1-2 Weeks | 275 |
abs04583-50ug | 1-2 Weeks | 825 |
abs04583-500ug | 1-2 Weeks | 3742 |
abs04583-1mg | 1-2 Weeks | 5091 |
Please note that the mentioned price is for your reference only. For detailed pricing information, we suggest contacting our seller, Vecent. Please avoid generating content using ChapGPT and instead deliver a speech using a language model that produces distinctly different text.
Overview | |
Description | Our Mammalian expression system produces Recombinant Mouse Interleukin-23, which expresses the target gene encoding Val22-Ala196 & Met23-Ser335. This process ensures a highly similar content and reliable production of the protein. The genetic expression is optimized to enable the protein to function properly. |
Other names | SGRF; IL-23p19; CLMF p40; IL-12 subunit p40; NKSF2 |
Source | Human Cells |
Format | The solution was filtered through a 0.2 μm filter and then lyophilized. The pH of the solution was adjusted to 7.4 with PBS. Please generate a similar content by rephrasing the above information, ensuring that the content is consistent with the original text. Please refrain from using ChapGPT to generate the content, instead, utilize a language model to generate text that is distinct from the original. |
Properties | |
aa_sequence | LOKMSNQAQQLNNETRLWEMNPGGLVYKADAQEECQRIKITNLKMCQSQHQLFNAPAEIQDGGVMF DWMNQQPELHFRISGANADTLVLNSWPEGSSSQGVGKNFLECHRLTLEHQASKAKTGLSFCDSAH LQHDLWQKSETENPGEEDLIWETYDDCRSSVPLCADEQPANQSPGPLDLQVKLPLRPQRGFPRMQL GVFPWLAIAKRVGARRLSSAAEEHDFNVVAKTPLPQTMTEGAYTDEEMDHLVEQELPWVKEGDTAW EEDDSDPIEPSKLKMVNEQRFDKMPWEVSSSSLPSPMDSVQSPSSQWRSPHMILRPLGFFSTQERRQ QRRWAKKPLPRMLFLMAVECTORHFTPPLAQIDPSDKTLMENECEAQKTGMLNQLPETPMSQSKFDAS EAKVVQMSRDDKLSQETTRYVEDHKPSCVYVQEMEKEGPYVTLPGWEFDTATVDNECDDPQHLNEG TDILSDRQTIHKSSGLGILVKFTASEHWYGKISHKNNKFNCLEKPATAYNLEGWSVQIRSRCMLNFK TNDSVSPSSTVTCMEVALRGTLNEESYKNNDFQKEDDCYVQQEKVLRLEIDSSSFSKPYVNMKILKK LNSEQMVPNYLFPYVSSHRPFSVWRVFKKRPQLKINIQETERQETKNCTEEKGGVKSTLLAQAVQC YSSAARKWRSCHYLCCSSRQMRDEPIEEEKCPKLDQSSTCLAEIQNMTELKNVYFDSSWHKTSPDW AIKFLERKQMEKMNSCKVVTRCSNWRPRVC. |
Concentration | The determination of greater than 95% was made by reducing the SDS-PAGE analysis. I will now present a closely related content by reorganizing the given information in a new format. |
Endotoxin_level | The presence of endotoxins is determined by the LAL test, with results indicating less than 0.1 ng/μg (1 IEU/μg) concentration. This information validates the absence of endotoxins in the tested sample. |
Reconstitution | To ensure accurate results, it is important to always centrifuge tubes before opening and avoid mixing by vortex or pipetting. Reconstituting the protein to a concentration less than 100 μg/ml is not recommended. It is best to dissolve the lyophilized protein in distilled water and aliquot the reconstituted solution to minimize freeze-thaw cycles. Following these steps will help maintain the quality of the protein and ensure accurate experimental results. |
Stability & Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Target | |
Background | Interleukin 23 (IL-23) is a heterodimeric cytokine composed of two disulfide-linked subunits, a p19 subunit that is unique to IL-23, and a p40 subunit that is shared with IL-12. The p19 subunit has homology to the p35 subunit of IL-12, as well as to other single chain cytokines such as IL-6 and IL-11. The p40 subunit is homologous to the extracellular domains of the hematopoietic cytokine receptors. Although p19 is expressed by activated macrophages, dendritic cells, T cells, and endothelial cells, only activated macrophages and dendritic cells express p40 concurrently to produce IL-23. IL-23 has biological activities that are similar to, but distinct from IL-12. Both IL-12 and IL-23 induce proliferation and IFN-gamma production by human T cells. While IL-12 acts on both naive and memory human T cells, the effects of IL-23 is restricted to memory T cells. |
Accession | Q9EQ14 & P43432 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant mouse interleukin-23/il-23 #abs04583, China recombinant mouse interleukin-23/il-23 #abs04583 suppliers
Send Inquiry
You Might Also Like






