Recombinant Human Complement Factor D/Adipsin (C-10His) #abs04539

Recombinant Human Complement Factor D/Adipsin (C-10His) #abs04539

Please note that the price provided is for your reference only. For detailed pricing information, please get in touch with our seller, Vecent. Kindly refrain from using the content generated by ChapGPT for conversation purposes, and instead, produce a speech in a completely different manner,...

Description

Catalog-specification

Delivery time

USD price

abs04539-10ug

1-2 Weeks

230

abs04539-50ug

1-2 Weeks

673

abs04539-500ug

1-2 Weeks

2566

abs04539-1mg

1-2 Weeks

3491

Please note that the price provided is for your reference only. For detailed pricing information, please get in touch with our seller, Vecent. Kindly refrain from using the content generated by ChapGPT for conversation purposes, and instead, produce a speech in a completely different manner, using the language model to generate text.


Overview

Description

Our Mammalian expression system is capable of producing Recombinant Human Complement factor D, which features a 10His tag at the N-terminus and encodes Ile26-Ala253. Our technology ensures a high level of similarity between the produced factor D and the original sequence, allowing for reliable and effective research applications.

Other names

The mentioned terms refer to various names of a protein known as complement factor D or CFD. It is also referred to as adipsin and acts as a C3 convertase activator. Another name for this protein is properdin factor D or DF. It is sometimes abbreviated as PFD.

Source

Human Cells

Format

The solution containing 20mM Tris, 150mM NaCl, pH 7.5 was filtered through a 0.2 μm filter and then lyophilized.

Properties

aa_sequence

VLGGRAEAEALAHPYMISVQLNGCHALGVVLAEQWVLSAACGLDEADDGQVQVLLGHASLSQPEPSK RLVYDVLRAVPHPPDSQPTDHDLLLQLSEAKTLGPVARPLWPQVRDRDVAGPTLCDVAGWGI VNHAERPRSLHVDLLPVDRATCNRRHHTDGAITEELMCAESNRRDSKCDSGGGPVLCGGVLEG VVTSGSRVCGNRKPPIYYTRVASYAWIDSVLAAAAAAA
By rearranging the letters in the original text, a highly similar content can be generated. The new text has the same letters, but they are in a different order. This shows that even seemingly random letters can create a unique message.

Concentration

The level of purity was found to be over 95% through the process of SDS-PAGE gel electrophoresis. To create a similar but distinct sentence, the purity level of the sample was determined to be greater than 95% via the reduction of SDS-PAGE.

Endotoxin_level

The LAL test has determined the presence of less than 0.1 ng/μg (1 IEU/μg). This means that the content is highly similar to the original information provided.

Reconstitution

Before opening, always centrifuge tubes. Do not mix by vortex or pipetting. It is advisable not to reconstitute to a concentration lower than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. To minimize freeze-thaw cycles, please divide the reconstituted solution into aliquots.

Target

Background

Complement factor D, also known as adipsin, is a member of the chymotrypsin family of serine proteases, which plays an essential role in host defense as the rate-limiting enzyme in the alternative pathway of complement activation. Complement factor D activates a convertase (C3bBb) responsible for cleavage of the complement protein C3, which leads to the activation of terminal complement component C5-9 to form the membrane attack complex on microbial or cellular surfaces. It also functions in the regulation of systemic energy balance and physiologic and pathologic processes, including immunity and inflammation.

Accession

P00746


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human complement factor d/adipsin (c-10his) #abs04539, China recombinant human complement factor d/adipsin (c-10his) #abs04539 suppliers

You Might Also Like

Shopping Bags