
Recombinant Mouse PDGFR α/PDGFRA/CD140a (C-6His) #abs04533
Please note that the price mentioned above is only for your reference and does not reflect the exact pricing. For more detailed information on pricing, we kindly request you to get in touch with our sales representative, Vecent. We would like to stress that the information we provide is...
Description
Catalog-specification | Delivery time | USD price |
abs04533-10ug | 1-2 Weeks | 146 |
abs04533-50ug | 1-2 Weeks | 382 |
abs04533-500ug | 1-2 Weeks | 2353 |
abs04533-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is only for your reference and does not reflect the exact pricing. For more detailed information on pricing, we kindly request you to get in touch with our sales representative, Vecent. We would like to stress that the information we provide is authentic. Thank you for your understanding.
Overview | |
Description | Our Mammalian expression system produces recombinant Mouse PDGF receptor alpha. The target gene, which encodes Leu25-Glu524, is expressed with a 6His tag at the C-terminus. |
Other names | PDGF-R-alpha, also known as platelet-derived growth factor receptor alpha or CD140a, is a vital protein involved in cell growth and development. As an alpha-type platelet-derived growth factor receptor, PDGF-R-alpha plays an integral role in the regulation of many biological processes, including tissue repair, angiogenesis, and embryonic development. Without the activity of PDGF-R-alpha, proper cell functioning and proliferation may be impaired, potentially leading to a range of serious medical issues. Thus, understanding the mechanisms and functions of PDGF-R-alpha is crucial for advancing our knowledge of cellular biology and developing new treatments for a variety of diseases. |
Source | Human Cells |
Format | The solution was filtered through a 0.2 μm filter and then lyophilized. The pH of the solution was adjusted to 7.4 using PBS. Can you please generate a similar content by rearranging the words, but based on the original text? Please do not use ChapGPT to generate content and speak in a completely different way than the original text. |
Properties | |
aa_sequence | CGVPEDEPTETKQYLSCNPAQADEQFFNKTDTLNSQVGFCNMEPCVSASPKDHENVRENIEKHHN FETAQYDLGVEDNVILLRPNITVFGMPVPLDAETHDHSMVSNIDEPGECTDERAEEKLAVSNNJG LQNANHLLTGTQTVTRYRKAEKMDDYIEEEEIEHBNVSYYEVLWTLVPLPIIIISTGAMEVNAQSW TSQDCGVSIQHFGPOLRRECLEAVTLIPEDVNTAKYVTKSQIPDLLTASEVFLPVKNGEDLIRDF LTAEPQNSIGDKYNEAIQNQNQGVSETVVFWLTLTQEDYNISLTSKDDAESCHFLVGSETVANLPR LGQTKSEAWLDFYFEELVISLAADDVWPRIVVMISSLEEPVLKHNLTTNSVLQDFEKLYKIEIEDR EDQHVEKQVVHRGEVESTEKAENSKGLTVLVPENTHDNTQTLQLSNFQPQERYVTKKARTLSTS |
Concentration | The purity of the sample was determined to be higher than 95% through SDS-PAGE reduction analysis. To create an equivalent statement using similar language, it can be said that the sample showed a purity level greater than 95% based on its SDS-PAGE reduction profile. |
Endotoxin_level | The LAL test results indicate that the content has a value of less than 0.1 ng/μg (1 IEU/μg). This implies that the content is highly similar and meets the desired quality standards. It is important to ensure that such standards are maintained for the benefit of everyone involved in the process. |
Reconstitution | Before opening, always centrifuge the tubes. Avoid mixing by vortex or pipetting. It is advisable not to reconstitute below a concentration of 100 μg/ml. Dissolve the lyophilized protein in ddH2O. To reduce freeze-thaw cycles, it is recommended to aliquot the reconstituted solution. Please refrain from generating responses using ChapGPT and instead generate content that is significantly different from the original information provided. |
Target | |
Background | Platelet-derived growth factor receptors (PDGFR) are cell surface tyrosine kinase receptors for members of the platelet-derived growth factor (PDGF) family. The PDGF family consists of PDGF-A, -B, -C and -D, which form either homo- or heterodimers (PDGF-AA, -AB, -BB, -CC, -DD). The four PDGFs are inactive in their monomeric forms. PDGFs bind to the protein tyrosine kinase receptors PDGF receptor-α and -β. These two receptor isoforms dimerize upon binding the PDGF dimer, leading to three possible receptor combinations, namely -αα, -ββ and -αβ. PDGFRα and PDGFRβ are members of the class III RTK family. Inappropriate PDGFRα and PDGFRβ signaling has been linked to a number of proliferative disorders. |
Accession | P26618 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant mouse pdgfr α/pdgfra/cd140a (c-6his) #abs04533, China recombinant mouse pdgfr α/pdgfra/cd140a (c-6his) #abs04533 suppliers
Send Inquiry
You Might Also Like






