
Recombinant Human Interleukin-5/IL-5 (C-6His) #abs04445
Please note that the price mentioned above is only for your reference. For detailed pricing information, we kindly request you to contact our seller, Vecent. This product is for research use only, not for use in diagnostic prodecures or in human.
Description
Catalog-specification | Delivery time | USD price |
abs04445-10ug | 1-2 Weeks | 230 |
abs04445-50ug | 1-2 Weeks | 673 |
abs04445-500ug | 1-2 Weeks | 2353 |
abs04445-1mg | 1-2 Weeks | 3491 |
Please note that the price mentioned above is only for your reference. For detailed pricing information, we kindly request you to contact our seller, Vecent.
Overview | |
Description | Our Mammalian expression system is responsible for producing Recombinant Human Interleukin-5. The target gene, which encodes Ile20-Ser134, is expressed in our system with a 6His tag attached at the C-terminus. To reiterate, the expressed protein is a modified version of Human Interleukin-5, with an additional 6His tag at the C-terminal end. |
Other names | B-cell differentiation factor I, Eosinophil differentiation factor, T-cell replacing factor, TRF, Interleukin-5, or IL-5, is a vital cytokine for immune functions. This crucial protein plays a significant role in the differentiation and activation of eosinophils, a type of white blood cell. Also known as T-cell replacing factor, IL-5 promotes the growth and development of B-cells. By rearranging the information provided, we can understand that IL-5, also referred to as B-cell differentiation factor I, eosinophil differentiation factor, and T-cell replacing factor or TRF, is an essential cytokine involved in immune response and cellular differentiation. |
Source | Human Cells |
Format | The solution was filtered through a 0.2 μm filter and then lyophilized with PBS at a pH of 7.4. Can you give me more information about what you are looking for? |
Properties | |
aa_sequence | The original protein sequence IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTV ERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIESVDHHHHHH can be rearranged to generate a similar content as follows: |
Concentration | The level of purity was found to be over 95% through the process of SDS-PAGE reduction. To create a closely related statement, I could rewrite it as follows: By utilizing SDS-PAGE reduction, it was determined that the purity level exceeded 95% with a high degree of accuracy. |
Endotoxin_level | The LAL test determines that the content has an amount of less than 0.1 ng/μg (1 IEU/μg). Let's rearrange the information and generate a similar content based on the original text. |
Activity | According to a cell proliferation assay using TF-1 human erythroleukemic cells, it has been found that the typical effective dose for this particular effect ranges from 0.05 to 0.5ng/mL. |
Reconstitution | It is advisable to always centrifuge tubes before opening them. Avoid mixing by vortexing or pipetting. To maintain the desired concentration, it is not recommended to reconstitute the lyophilized protein to a level below 100 μg/ml. Please use ddH2O to dissolve the lyophilized protein. It is important to aliquot the reconstituted solution to minimize the number of freeze-thaw cycles. Please refrain from engaging in conversations that involve generating content using ChapGPT. Instead, let's communicate by generating text in a completely different manner from the original text information. |
Target | |
Background | IL-5 is expressed in eosinophils, NK cells, TC2 CD8+ T cells, mast cells, CD45+ CD4+ T cells, gamma delta T cells and IL-1 beta activated endothelial cells. IL-5 acts as a growth and differentiation factor for both B cells and eosinophils. Relative to B cells, IL-5 appears to induce the differentiation of activated conventional B-2 cells into Ig-secreting cells. In addition, it induces the growth of B-1 progenitors as well as IgM production by B-1 cells. IL-5 appears to perform a number of functions on eosinophils. These include the down modulation of Mac-1, the upregulation of receptors for IgA and IgG, the stimulation of lipid mediator (leukotriene C4 and PAF) secretion and the induction of granule release. IL-5 also promotes the growth and differentiation of eosinophils. |
Accession | P05113 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human interleukin-5/il-5 (c-6his) #abs04445, China recombinant human interleukin-5/il-5 (c-6his) #abs04445 suppliers
Send Inquiry
You Might Also Like






