
Recombinant Human Neuroligin-1/NLGN1 (C-6His) #abs04341
Please note that the price provided above is only for your reference. For the detailed price, we kindly request you to reach out to our seller, Vecent. This product is for research use only, not for use in diagnostic prodecures or in human.
Description
Catalog-specification | Delivery time | USD price |
abs04341-10ug | 1-2 Weeks | 123 |
abs04341-50ug | 1-2 Weeks | 337 |
abs04341-500ug | 1-2 Weeks | 2353 |
abs04341-1mg | 1-2 Weeks | 3201 |
Please note that the price provided above is only for your reference. For the detailed price, we kindly request you to reach out to our seller, Vecent.
Overview | |
Description | Our Mammalian expression system is responsible for producing Recombinant Human Neuroligin 1, which consists of Gln46-Leu676 and a 6His tag at the C-terminus. The resulting product is highly similar to the original target gene and is suitable for various research applications. |
Other names | Neuroligin-1, NLGN1, KIAA1070 |
Source | Human Cells |
Format | The pH 7.2 solution containing 20mM PB and 150mM NaCl was filtered through a 0.2 μm filter before being lyophilized. |
Properties | |
aa_sequence | NTGQVYNAIRYILPTDGGDLAKLENIVLGFVQIPGVAPYYEFPGRPREIQPSWPEDSPFATVCNT APIGRDLQNIDELPVVMLWFSLNNTVSDSVYDVQSDYECILYTNGPIDRVDIVYEPNSTMGKPVM HIYHSGLYEMTGNLYDGSVLASFGNIVITVNRSLGVLGFLSTGDQKAKKNYGLLDLIQALRW TSENIFFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTALSSWAV SFQPAKYARMLATKVGCDVSNTELVECLQPKKYELVDQDIQPARYHIAFGPVIDGDVIPDDPQ LLMEQGELNYDIMLGVNQGEGLKFVENIVDFDDGISASDFDFAVSNFVDNLYGYPEGKDVLRET IKFMYTDWADRHNPETRRKTLLALFTDHQWVAPAVATADLHSNFGSPTYFYAFYHHCQTDQVPAW ADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHT KPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVP STDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELVDHHHHHHQKLDDVDPLVATNFGKIRGIKKELNNEILGPVIQFLGVPYAAPPTGERRFQPPEPPSPWSDIRNA TQFAPVCPQNIIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTEDDIRDSGGPKPV MVYIHGGSYMEGTGNLYDGSVLASYGNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDLIQALRW TSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTALSSWAV SFQPAKYARMLATKVGCNVSDTVELVECLQKKPYKELVDQDIQPARYHIAFGPVIDGDVIPDDPQ ILMEQGEFLNYDIMLGVNQGEGLKFVENIVDSDDGISASDFDFAVSNFVDNLYGYPEGKDVLRET IKFMYTDWADRHNPETRRKTLLALFTDHQWVAPAVATADLHSNFGSPTYFYAFYHHCQTDQVPAW ADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHT KPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVP STDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELVDHHHHHH. |
Concentration | SDS-PAGE,95%。,。,ChapGPT。 |
Endotoxin_level | According to the LAL test, the measurement of less than 0.1 ng/μg (1 IEU/μg) indicates a negligible amount of endotoxins present. We aim to maintain this level of endotoxin concentration in our products to ensure their safety and effectiveness. |
Reconstitution | To ensure proper handling and accuracy, it is essential to keep in mind some important guidelines. Before opening any tubes, always remember to centrifuge them. Avoid using vortex or pipetting methods for mixing purposes. It is advisable not to reconstitute the lyophilized protein to a concentration lower than 100 μg/ml. For dissolution, it is recommended to use ddH2O. However, once reconstituted, it is crucial to aliquot the solution in order to minimize the occurrence of freeze-thaw cycles. By adhering to these instructions, you can ensure the optimal preservation and usage of the protein. |
Target | |
Background | Neuroligin-1 is a single-pass type I transmembrane protein which belongs to the type-B Carboxylesterase/Lipase family. Neuroligins are cell-adhesion molecules located at the postsynaptic side of the synapse. Neuroligins interact with beta-neurexins and this interaction is involved in the formation of functional synapses. Neurexins and Neuroligins are cell adhesion molecules present in excitatory and inhibitory synapses, and they are required for correct neuron network function. These proteins are found at the presynaptic and postsynaptic membranes. Neuroligin-1 is a neuronal cell surface protein which is thought to be involved in cell-cell-interactions by forming intercellular junctions through binding to beta-neurexins. It seems to play role in formation or maintenance of synaptic junctions. It triggers the de novo formation of presynaptic structures and may be involved in specification of excitatory synapses. |
Accession | Q8N2Q7 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human neuroligin-1/nlgn1 (c-6his) #abs04341, China recombinant human neuroligin-1/nlgn1 (c-6his) #abs04341 suppliers
Send Inquiry
You Might Also Like






