Recombinant Human Osteoactivin/GPNMB (C-6His) #abs04342

abs04342-10ug

1-2 Weeks

123

abs04342-50ug

1-2 Weeks

337

abs04342-500ug

1-2 Weeks

2353

abs04342-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system is responsible for producing Recombinant Human 0 with a 6His tag at the C-terminus. The target gene, which encodes Ala22-Pro486, is expressed to create a highly pure and effective product. By utilizing this advanced technology, we are able to offer customers a superior quality protein with excellent consistency.

Other names

NMB, HGFIN, and GPNMB are all transmembrane glycoproteins that play important roles in different physiological processes. NMB, also known as Glycoprotein NMB, is involved in cell adhesion, migration, and proliferation. HGFIN, or Transmembrane Glycoprotein HGFIN, is implicated in various cancer types as well as in immune response modulation. GPNMB, meanwhile, or Glycoprotein Non-Metastatic Melanoma Protein B, is known for its roles in osteoblast differentiation, melanoma progression, and Alzheimer's disease.
These transmembrane glycoproteins share certain characteristics, such as having a single transmembrane domain, a heavily glycosylated extracellular region, and an intracellular tail that contains different signaling motifs. Their expression patterns and regulatory mechanisms, however, differ depending on the tissue or cell type they are in. For instance, NMB is overexpressed in breast cancer and associated with poor prognosis, while HGFIN is upregulated in glioblastoma and associated with increased invasion and angiogenesis.
Despite their distinct functions and implications in various diseases, these transmembrane glycoproteins represent potential targets for therapeutic interventions. Targeting their signaling pathways or perturbing their interactions with other proteins can result in beneficial outcomes in different contexts. Thus, further studies are needed to unravel their precise roles and potential utilities in different diseases.

Source

Human Cells

Format

The solution was filtered through a 0.2 μm filter and then lyophilized. It originally contained 20mM PB, 150mM NaCl, and had a pH of 7.2. Hoping this rearrangement captures the essence of the original content!

Properties

aa_sequence

DVLMGNGWESKSNEQPDMASHYLDTTREANTKNSRSADRGKWLDRSYYKPWRQWDGAHSVPVSGLAYVNQCFLINADPIEGKSRVENPTPNFWTVLHYAKRQIGSRGGPHFTLVNASSPDDQSYVGEFKDNTGHEGSAQNLPFKRCHGSHRNYLYVGGWLRPITDFQAPVNLFYVTGIPQIKFNVNMVRVTDRQPRQNKDSSLDYLLTNRFLVFNPGSNFVVNTMNVGNWYSTGPQIYFVLIHDCVARSNGRLCVLITSYNTSVGLHPDNVTGRPLVVVMPKTQDFGITWLLTSNHNNGKDVFGVLNSTSDPLTDNPAKCNDQDQFRSPVENHTWGQHPLMNFGDNNSCTIEISPSINCCDTPLVDATSLVCEVSGSKVIRHKDLLTVHFNLVTTVNLSFPKGNTSPWYQNIYCPFVANWFDPIYSSRVAFPDLTPTTGLKLAPLVTDSNSPPRYRDHPDHSNYIPYKFGITQGSSFLNVKNLICGVNSEPSNTDKTWTAHIHNFPFKTPSSVPTPSPPGPSPRGPCKPLASLNDDSGANAELRGDPQENDYCRHNQAGGNIAAPSEDCEVTNMVYWYTTNTLNAGTYPLVDENCYKDIQPDSVHYMKLVRSAGIQESP IFCWGCNGRLEYPVLNITFNDNKTDSNYHYPLMFFQQDNRKLAEIGITVKSQIHVEVGNIQFQIVPNILIMLMRDTVTPEVSNWDMEWNYHHQSLKSLGKSVILGLICCNTPLPNRPARNISVPNSVSEQS...

Concentration

SDS-PAGE，95%。，，。

Endotoxin_level

The LAL test determined that the concentration is below 0.1 ng/μg (1 IEU/μg). Please rearrange the given information to generate highly similar content.

Reconstitution

It is important to always centrifuge tubes before opening and avoid mixing by vortex or pipetting to ensure accurate results. Reconstitution to a concentration less than 100 μg/ml is not recommended. The lyophilized protein should be dissolved in ddH2O. To prevent degradation, it is advised to aliquot the reconstituted solution and minimize freeze-thaw cycles. Taking these precautions can help ensure optimal protein stability and performance.

Target

Background

Osteoactivin is an intracellular glycoprotein belongs to the NMB/pMEL-17 family, which is asscociated with cell endosomal / lysomal compartments. Human Osteoactivin is a 560 amino acid type I transmembrane protein, and one alternate splice form shows a 12 amino acid insert between amino acid 339-340. An additional 206 amino acid isoform shows a mutation at position 181 that results in a 26 amino acid substitution for the C-terminal 380 amino acids. Cells knowns to express Osteoactivin include fibroblast, osteoblasts, myeloid dendritic cell, melanocytes, plus fetal chondrocytes and stratum basale keratinocytes, macrophages / keratinocytes.

Accession

Q14956