
Recombinant Human Interferon α/β Receptor 1/IFNAR1 (C-6His) #abs04328
Please note that the price provided above is only for your reference. For detailed pricing information, please get in touch with our seller, Vecent. We kindly request you to generate unique content by rephrasing the original text, maintaining the information given. This product is for research...
Description
Catalog-specification | Delivery time | USD price |
abs04328-10ug | 1-2 Weeks | 123 |
abs04328-50ug | 1-2 Weeks | 337 |
abs04328-500ug | 1-2 Weeks | 2353 |
abs04328-1mg | 1-2 Weeks | 3201 |
Please note that the price provided above is only for your reference. For detailed pricing information, please get in touch with our seller, Vecent. We kindly request you to generate unique content by rephrasing the original text, maintaining the information given.
Overview | |
Description | Our Mammalian expression system is responsible for producing Recombinant Human Interferon alpha/beta Receptor 1. This protein is encoded by the target gene Lys28-Lys436 and is expressed with a 6His tag located at the C-terminus. To provide a similar content, the original text information was rearranged. |
Other names | IFNAR1, also known as Interferon Alpha/Beta Receptor 1 or IFN-R-1, is a cytokine receptor involved in the immune response. It belongs to the Cytokine Receptor Class-II Member 1 or Cytokine Receptor Family 2 Member 1. Its alternate name is CRF2-1. IFNAR1 is a crucial component of the Type I Interferon Receptor, which plays a critical role in the body's ability to defend against viral infections and regulate immune responses. Understanding the function and structure of IFNAR1 is of great importance in deciphering the mechanisms of immune system activation and developing targeted therapies for various diseases. |
Source | Human Cells |
Format | pH 7.2, lyophilized from a solution of 20mM PB and 150mM NaCl, which was filtered through a 0.2 μm filter. |
Properties | |
aa_sequence | YKWNLSSVGKIKIRAAETNSESWEVDSITYLFRKPIQGPPAVHLEADDIAKIHSIPGKTSVDMSAW LLDGSFYTVLIWSNSKGEEIRIENSYSRKYIHPSLTYCEVKALTLKWVSIGYEPVICHKTTNEVE LPPNPENISEVVSNQNYYVLKWDTYAMFVQTQFLVQWHALFKNRGNHPYKLWKQIDPDCENVTQT VFCFPQVNFQKGLYILRVQASDGSNNTSFWESEIKFDTEQIAFLPLPVFNIRSLSHDFHIYIGAP KQSGNTPVIDQYIPEILEINTSWNAEKRIIKEKTDVTVPLNKPLVTYVCKARAHMDKEKLNKSSVF SDAVCEKTKPGNTSKLDHHHHHHKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQKTGM DNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQIGPPEVHL EAEDKAIVIHISPGTKDSVMWA |
Concentration | SDS-PAGE95%。,。 |
Endotoxin_level | The LAL test determines that the concentration is below 0.1 ng/μg (1 IEU/μg) accordingly. Let me generate a distinctive statement using the same information. |
Reconstitution | Before opening your tubes, always spin them in a centrifuge. Avoid mixing them with vortex or pipetting techniques. It is not recommended to dilute your protein to less than 100 μg/ml. When reconstituting your lyophilized protein, use only ddH2O. To minimize freeze-thaw cycles, please divide your reconstituted solution into aliquots. Remember to create new content by rearranging the information provided above whilst ensuring that it stays true to the original text. |
Target | |
Background | The Interferon-α/β Receptor 1 (IFN-α/β R1) is a receptor which binds Type I Interferons including Interferon-α and -β. It is a cell surface receptor and heteromeric receptor composed of one chain with two subunits referred to as IFNAR1 and IFNAR2. IFN-α/β R1, in association with IFN-α/β R2, is required for propagating antiviral signal transduction triggered by IFN-α and IFN-β. IFN-α/β R1 interacts very weakly or not at all with type 1 interferons and does not stably interact with IFN-α/β R2. Ligands associate with IFN-α/β R2, and this complex subsequently forms a stable ternary assembly with IFN-α/β R1. IFN-α/β R1 also associates with IFN-γ R2 even in the absence of IFN-γ stimulation. Human IFN-α/β R1 contains a nuclear localization signal in its extracellular domain that is required for receptor translocation to the nucleus following interaction with ligand. Interferon stimulation results in an immunologic response that is especially associated with viruses. |
Accession | P17181 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human interferon α/β receptor 1/ifnar1 (c-6his) #abs04328, China recombinant human interferon α/β receptor 1/ifnar1 (c-6his) #abs04328 suppliers
Send Inquiry
You Might Also Like






