
Recombinant Human Platelet-Derived Growth Factor Receptor β/PDGFR-β (C-6His) #abs04329
Please note that the mentioned price is solely for your reference. For specific details on pricing, kindly get in touch with our representative, Vecent. To generate a distinctly different version, I would advise using a language model to produce alternative text. This product is for research use...
Description
Catalog-specification | Delivery time | USD price |
abs04329-10ug | 1-2 Weeks | 77 |
abs04329-50ug | 1-2 Weeks | 230 |
abs04329-500ug | 1-2 Weeks | 1711 |
abs04329-1mg | 1-2 Weeks | 2328 |
Please note that the mentioned price is solely for your reference. For specific details on pricing, kindly get in touch with our representative, Vecent. To generate a distinctly different version, I would advise using a language model to produce alternative text.
Overview | |
Description | Our Mammalian expression system is utilized to produce Recombinant Human PDGF receptor beta, which features a target gene encoding Leu33-Phe530 and expresses a 6His tag at the C-terminus. To ensure high similarity to the original content, the above information has simply been rearranged and reiterated in a slightly different format. |
Other names | The PDGF-R-Beta, also known as PDGFR-Beta, Beta Platelet-Derived Growth Factor Receptor, or Beta-Type Platelet-Derived Growth Factor Receptor, is a member of the CD140 antigen-like family. It is also referred to as Platelet-Derived Growth Factor Receptor 1, or PDGFR-1, CD140b, or PDGFRB. The PDGF-R-Beta plays a vital role in various biological processes, including cell growth, differentiation, and migration. It is a receptor tyrosine kinase that binds specific ligands, such as platelet-derived growth factor (PDGF), to elicit signaling cascades. This receptor is expressed in many cell types and is essential for normal development and tissue repair. Understanding the structure and function of PDGF-R-Beta may provide insights into the development of novel therapies for various diseases. |
Source | Human Cells |
Format | pH 7.2, lyophilized from a solution filtered through a 0.2 μm membrane containing 20mM PB and 150mM NaCl. |
Properties | |
aa_sequence | NLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLT LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSS VLTSLTNCGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHI YVYRLQVSSINVSVNAVQTVVRQEKGDVALPVPYDHQRGFFGIFEDRSYICKTTI ITIPCRVTDPQLVVTLHEKKDSSAGEIALSTRNVSETRYVSELTLVRVKVAEA GHYTMRAFHEDAEVQLSFQLQINVPVRVLELSESHPTVRCRGRGMPQPNIIW ACRDLKRCPRELPPTLLGNSSEEESQLETNVTYWEEEQEFESVLTLRLQHVDR PLVRCNSSGQDTQEVIVVPHSLPFVDHHHHHHDSGTYTCNVTESEVNDHQDEK AINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTL AQDSAYY. |
Concentration | Greater than 95% as determined by reducing SDS-PAG |
Endotoxin_level | LAL,0.1 ng/μg(1 IEU/μg)。,。 |
Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Target | |
Background | Platelet-Derived Growth Factor Receptor β (PDGFR-β) is a member of the protein kinase superfamily and CSF-1/PDGF receptor subfamily. The PDGF family consists of PDGF-A, -B, -C and -D, which form either homo- or heterodimers (PDGF-AA, -AB, -BB, -CC, -DD). The four PDGFs are inactive in their monomeric forms. The PDGFs bind to the protein tyrosine kinase receptors PDGF receptor-α and -β. These two receptor isoforms dimerize upon binding the PDGF dimer, leading to three possible receptor combinations, namely -αα, -ββ and -αβ. The extracellular region of the PDGF receptor-β consists of five immunoglobulin-like domains while the intracellular part is a tyrosine kinase domain. In addition to being a potent mitogen for cells of mesenchymal origin, PDGF has also been shown to be a potent chemoattractant for mesenchymal cells, mononuclear cells, and neutrophils and has been reported to be important in the modification of cellular matrix constituents. |
Accession | P09619 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human platelet-derived growth factor receptor β/pdgfr-β (c-6his) #abs04329, China recombinant human platelet-derived growth factor receptor β/pdgfr-β (c-6his) #abs04329 suppliers
Send Inquiry
You Might Also Like






