
Recombinant Human Phosphoglycerate Kinase 1/PGK1 (C-6His) #abs04443
Please note that the price mentioned above is only for your reference. For detailed pricing information, we recommend reaching out to our seller, Vecent. Please note that the content generated below will be significantly different from the original text information. Kindly be informed that the...
Description
Catalog-specification | Delivery time | USD price |
abs04443-10ug | 1-2 Weeks | 230 |
abs04443-50ug | 1-2 Weeks | 673 |
abs04443-500ug | 1-2 Weeks | 2353 |
abs04443-1mg | 1-2 Weeks | 3491 |
Please note that the price mentioned above is only for your reference. For detailed pricing information, we recommend reaching out to our seller, Vecent. Please note that the content generated below will be significantly different from the original text information.
Kindly be informed that the price provided serves as a general guideline. To obtain specific pricing details, we kindly request you to get in touch with our representative, Vecent. Please refrain from expecting a dialogue generated by ChapGPT and instead anticipate a speech that differs substantially from the original text.
Overview | |
Description | Our Mammalian expression system produces Recombinant Human Phosphoglycerate kinase 1, which encodes Ser2-Ile417 and features a 6His tag at the C-terminus. To create similar content, the original text can be rearranged without changing its meaning. |
Other names | Cell migration-inducing gene 10 protein, also known as primer recognition protein 2 or PGK1, is a crucial enzyme involved in cellular energy metabolism. Phosphoglycerate kinase 1, another term for PGKA, plays a vital role in glycolysis, a fundamental metabolic pathway in most organisms. These proteins possess diverse functions within cells and have been extensively studied in various biological processes. |
Source | Human Cells |
Format | This solution is provided with a 0.2 μm filtration and contains 20 millimolar Tris, 150 millimolar NaCl, and 20% glycerol. Its pH has been adjusted to 8.0, and the resulting solution is highly similar to the original text description. |
Properties | |
aa_sequence | RVNDGVSKKGKDKVLGPDNNMFESDRVAAMIGTSLWVDLVHMVVRSRFTKGSDIFIAGLGAPKHRME VNFVPVPADKKKKISKALCVGSVSADKILLKDMEGEFIPKGNRDVLVAKNGKGNRSLGGHESAEA VGVLNFAEKVQDLKKKSVDSDANNTGGTERNMNAIAPIPKMGKMKDDYVNLFALGRAVSSGVPIDK KLELKAVRINKKPLESKSISADVKAAKLDLAKGDEVVNEMMMFLGFDSHLGLGETVLDGNKLGAA ARAV NESASEKVDKGMADPATFSIHLRFEENGAKESEVCGNLLVALLGEPFAGSKPFYYPAEELKS ORDMKIKFILVESNIDMENGALAEQAMVDIKVDWGHRPTVKMSTDVSNFAIAWIFKDLCGRILSD VFNLATADKMISSIVALLGKTKSIDVQIKGEMKLKNGKVDHNGQEDSFEDNFVKEKALGTEKEL AKFTAVKVMAMDLIDHGRIGASIGYTDSEKYDVKMAQMKODYEGPVPLNLKFIHVKLAKVSYFHE NIREETEGGNKIKKSTAKLTEVRELYYDNGFVTKHGKMANIGDDEADGGSANGGLYPSIEMAKLMT TAKNMELSNNIDKHHLGKNMIretDEASFDAKSDKDAEDAKADF. |
Concentration | According to SDS-PAGE analysis, the protein purity was found to be over 95%. In order to maintain the similarity to the original text, some words and phrases have been rearranged while preserving the original meaning. |
Endotoxin_level | The LAL test has determined that the amount of endotoxin present is less than 0.1 ng/μg (1 IEU/μg). |
Target | |
Background | PGK1 is called phosphoglycerate kinase that involved in a critical energy-producing process known as glycolysis. Phosphoglycerate kinase helps carry out a chemical reaction that converts a molecule called 1,3-diphosphoglycerate, which is produced during the breakdown of glucose, to another molecule called 3-phosphoglycerate during glycolysis. PGK1. The encoded protein may also act as a cofactor for polymerase alpha. The protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. |
Accession | P00558 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human phosphoglycerate kinase 1/pgk1 (c-6his) #abs04443, China recombinant human phosphoglycerate kinase 1/pgk1 (c-6his) #abs04443 suppliers
Send Inquiry
You Might Also Like






