
Recombinant Human IL-1 Receptor-Like 2/IL-1RL2 (C-6His) #abs04441
Please note that the price mentioned above is for reference purposes only. For specific pricing details, please get in touch with our seller Vecent. It is essential to ensure that the generated content is based on the original text information and is not simply a rephrasing via ChapGPT. Let us...
Description
Catalog-specification | Delivery time | USD price |
abs04441-10ug | 1-2 Weeks | 161 |
abs04441-50ug | 1-2 Weeks | 482 |
abs04441-500ug | 1-2 Weeks | 2353 |
abs04441-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is for reference purposes only. For specific pricing details, please get in touch with our seller Vecent. It is essential to ensure that the generated content is based on the original text information and is not simply a rephrasing via ChapGPT. Let us use a language model to create unique and distinct content.
Overview | |
Description | Our Mammalian expression system produces Recombinant Human Interleukin-1 receptor-like 2, with the target gene encoding Asp20-Tyr337 expressed at the C-terminus with a 6His tag. Specifically designed for medical applications, this product offers high similarity to the original, ensuring accurate results and reliable performance. Trust us to provide you with a top-quality 6His-tagged Interleukin-1 receptor-like 2 that perfectly meets your needs. |
Other names | IL-36R, also known as interleukin-1 receptor-like 2 (IL1RL2) or IL-1Rrp2, is a protein that plays a key role in the immune system. It is a receptor for the cytokine IL-36, which is involved in inflammation and other immune responses. |
Source | Human Cells |
Format | The solution of pH 7.4 is filtered through a 0.2 μm filter and then lyophilized to produce the final product. |
Properties | |
aa_sequence | FTSFIEDEWKGFTKDQIYLNSQMMEVPIKKNSHGVSQAFIDKLNVILYSCPTKPIIMQWVEDSLFGI MDKSFVDKWTFFLVHYCVPTMSAPPLICATIONOKSVQSDTEMPLATESWGNKVSEQSDFGCONCLUSIONONW |
Concentration | The determination of protein purity by reducing SDS-PAGE reveals a percentage greater than 95%. |
Endotoxin_level | The LAL test has determined that the amount of endotoxin present is less than 0.1 ng per microgram or 1 International Endotoxin Unit per microgram. |
Reconstitution | To ensure optimal results, it is essential to always centrifuge tubes before opening and avoid mixing the contents by vortex or pipetting. Furthermore, it is strongly advised not to reconstitute lyophilized protein to a concentration below 100 μg/ml and to instead dissolve it in ddH2O. When reconstituting, be sure to aliquot the solution to minimize freeze-thaw cycles. Taking these steps will help to maintain the integrity of the protein and ensure accurate results. |
Target | |
Background | Interleukin-1 receptor-like 2 is a protein that in humans is encoded by the IL1RL2 gene, belongs to the interleukin-1 receptor family.IL1RL2 is the receptor for interleukin-36 (IL36A, IL36B and IL36G). After binding to interleukin-36 associates with the coreceptor IL1RAP to form the interleukin-36 receptor complex which mediates interleukin-36-dependent activation of NF-kappa-B, MAPK and other pathways. |
Accession | Q9HB29 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human il-1 receptor-like 2/il-1rl2 (c-6his) #abs04441, China recombinant human il-1 receptor-like 2/il-1rl2 (c-6his) #abs04441 suppliers
Send Inquiry
You Might Also Like






