Recombinant Human IL-1 Receptor-Like 2/IL-1RL2 (C-6His) #abs04441

Recombinant Human IL-1 Receptor-Like 2/IL-1RL2 (C-6His) #abs04441

Please note that the price mentioned above is for reference purposes only. For specific pricing details, please get in touch with our seller Vecent. It is essential to ensure that the generated content is based on the original text information and is not simply a rephrasing via ChapGPT. Let us...

Description

Catalog-specification

Delivery time

USD price

abs04441-10ug

1-2 Weeks

161

abs04441-50ug

1-2 Weeks

482

abs04441-500ug

1-2 Weeks

2353

abs04441-1mg

1-2 Weeks

3201

Please note that the price mentioned above is for reference purposes only. For specific pricing details, please get in touch with our seller Vecent. It is essential to ensure that the generated content is based on the original text information and is not simply a rephrasing via ChapGPT. Let us use a language model to create unique and distinct content.


Overview

Description

Our Mammalian expression system produces Recombinant Human Interleukin-1 receptor-like 2, with the target gene encoding Asp20-Tyr337 expressed at the C-terminus with a 6His tag. Specifically designed for medical applications, this product offers high similarity to the original, ensuring accurate results and reliable performance. Trust us to provide you with a top-quality 6His-tagged Interleukin-1 receptor-like 2 that perfectly meets your needs.

Other names

IL-36R, also known as interleukin-1 receptor-like 2 (IL1RL2) or IL-1Rrp2, is a protein that plays a key role in the immune system. It is a receptor for the cytokine IL-36, which is involved in inflammation and other immune responses.
IL-36R is expressed on a variety of immune cells, including T cells, B cells, monocytes, and dendritic cells. When IL-36 binds to IL-36R, it triggers signaling pathways that lead to the activation of pro-inflammatory genes.
Research has shown that IL-36R is involved in a number of inflammatory diseases, including psoriasis, lupus, and rheumatoid arthritis. Inhibiting IL-36R may therefore be a potential therapeutic strategy for these conditions.
Overall, IL-36R is an important receptor in the immune system that plays a role in regulating inflammation and immune responses.

Source

Human Cells

Format

The solution of pH 7.4 is filtered through a 0.2 μm filter and then lyophilized to produce the final product.

Properties

aa_sequence

FTSFIEDEWKGFTKDQIYLNSQMMEVPIKKNSHGVSQAFIDKLNVILYSCPTKPIIMQWVEDSLFGI MDKSFVDKWTFFLVHYCVPTMSAPPLICATIONOKSVQSDTEMPLATESWGNKVSEQSDFGCONCLUSIONONW

Concentration

The determination of protein purity by reducing SDS-PAGE reveals a percentage greater than 95%.

Endotoxin_level

The LAL test has determined that the amount of endotoxin present is less than 0.1 ng per microgram or 1 International Endotoxin Unit per microgram.

Reconstitution

To ensure optimal results, it is essential to always centrifuge tubes before opening and avoid mixing the contents by vortex or pipetting. Furthermore, it is strongly advised not to reconstitute lyophilized protein to a concentration below 100 μg/ml and to instead dissolve it in ddH2O. When reconstituting, be sure to aliquot the solution to minimize freeze-thaw cycles. Taking these steps will help to maintain the integrity of the protein and ensure accurate results.

Target

Background

Interleukin-1 receptor-like 2 is a protein that in humans is encoded by the IL1RL2 gene, belongs to the interleukin-1 receptor family.IL1RL2 is the receptor for interleukin-36 (IL36A, IL36B and IL36G). After binding to interleukin-36 associates with the coreceptor IL1RAP to form the interleukin-36 receptor complex which mediates interleukin-36-dependent activation of NF-kappa-B, MAPK and other pathways.

Accession

Q9HB29


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human il-1 receptor-like 2/il-1rl2 (c-6his) #abs04441, China recombinant human il-1 receptor-like 2/il-1rl2 (c-6his) #abs04441 suppliers

You Might Also Like

Shopping Bags