Recombinant Human S100 Calcium Binding Protein A6/S100A6 (N-6His) #abs04438

Recombinant Human S100 Calcium Binding Protein A6/S100A6 (N-6His) #abs04438

Please note that the price mentioned above is for reference purposes only. For detailed pricing information, kindly reach out to our sales representative, Vecent. Alternatively, you may contact us through our customer support channels for further assistance. We value your business and look...

Description

Catalog-specification

Delivery time

USD price

abs04438-10ug

1-2 Weeks

77

abs04438-50ug

1-2 Weeks

230

abs04438-500ug

1-2 Weeks

1146

abs04438-1mg

1-2 Weeks

1528

Please note that the price mentioned above is for reference purposes only. For detailed pricing information, kindly reach out to our sales representative, Vecent. Alternatively, you may contact us through our customer support channels for further assistance. We value your business and look forward to hearing from you soon.


Overview

Description

Our E.coli expression system is utilized to produce Recombinant Human S100 calcium binding protein A. The target gene, which encodes Met1-Gly90, is expressed with a 6His tag located at the N-terminus. To maintain the original information, please rearrange the content without relying on ChapGPT's conversation mode and instead generate a completely distinct speech using the language model.

Other names

Protein S100-A6, also known as S100A6, Calcyclin, Growth factor-inducible protein 2A9, MLN 4, Prolactin receptor-associated protein (PRA), or CACY, is a calcium-binding protein. It plays a significant role in many cellular processes. S100A6 is highly similar to other S100 proteins, as it contains two EF-hand calcium-binding motifs. However, it exhibits distinct functionality and expression patterns. S100A6 is frequently induced by growth factors and participates in various signaling pathways. It is involved in cell proliferation, differentiation, and apoptosis. Additionally, S100A6 has been associated with numerous diseases and disorders, including cancer, neurodegenerative diseases, and inflammation. Its diverse functions make S100A6 an intriguing protein, deserving further research and exploration.

Source

Escherichia coli.

Format

pH7.4PBS,0.2 μm。,。

Properties

aa_sequence

GKSLEVDRIHGMQAEKKKLSKKELKGDIQGERGLKEDLSDQLACHSHMMACPMEYLTFLGQHKNNKEILOMFLTAAVIFHKYSGVEIGQINGDYSGEMILLFDKHTLSKAAFDALAAIYNEALKELIQKELTIPLMEAEEIDFBAIGEDRNKDQEVNFQGHSSMMSLSHHHHVPAACGLLVAIF

Concentration

SDS-PAGE,95%。,。

Endotoxin_level

The LAL test has determined that the amount of endotoxin present is less than 0.1 ng/μg (1 IEU/μg).

Target

Background

Calcyclin, also known as S100A6 or Growth factor-inducible protein 2A9, is a member of the S100 family of proteins that have two EF-hand calcium-binding motifs. These proteins are found in the cytoplasm and/or nucleus of various cells in vertebrates and play crucial roles in several fundamental biological processes, including enzyme activities, protein phosphorylation, transcription factors, cell growth and differentiation, and regulation of the inflammatory response. S100A6 is also implicated in Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis.
This gene has been linked to melanoma, and its expression and chromosomal rearrangements have also been implicated. S100A6 acts as a calcium sensor and modulator, contributing to cellular calcium signaling and interacting with other proteins, such as TPR-containing proteins. Overall, it may indirectly play a role in many physiological processes, including reorganizing the actin cytoskeleton and promoting cell motility.

Accession

P06703


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human s100 calcium binding protein a6/s100a6 (n-6his) #abs04438, China recombinant human s100 calcium binding protein a6/s100a6 (n-6his) #abs04438 suppliers

You Might Also Like

Shopping Bags