Recombinant Human Follistatin-Related Protein 1/FSTL1 (C-6His, E. Coli) #abs04409

abs04409-10ug

1-2 Weeks

161

abs04409-50ug

1-2 Weeks

482

abs04409-500ug

1-2 Weeks

2566

abs04409-1mg

1-2 Weeks

3491

Description

Our E.coli expression system is used to produce Recombinant Human Follistatin-like Protein 1. The target gene, which encodes Glu21-Ile308, is expressed with a 6His tag at the C-terminus. Please generate new content that is highly similar to the original text by rearranging the provided information. However, make sure that the generated content is distinctly different from the output generated by ChapGPT and deliver the speech in a different manner.

Other names

Follistatin-Like Protein 1, also known as FSTL1 or FRP, is a protein that is closely related to Follistatin-Related Protein 1. These proteins play important roles in various biological processes. FSTL1 shares significant sequence similarity with FRP, indicating their close evolutionary relationship.
Follistatin-Related Protein 1, abbreviated as FRP, and its variant Follistatin-Like Protein 1, commonly referred to as FSTL1, are two proteins with important functional implications. Both FRP and FSTL1 exhibit closely related properties and are involved in numerous biological processes. The close similarity between these proteins suggests their evolutionary connection and potential overlapping functions.
FRP, also known as Follistatin-Related Protein 1, and Follistatin-Like Protein 1 (FSTL1) are two proteins that share significant sequence identity. These proteins are crucial in various biological processes and possess similar characteristics. FSTL1, an isoform of FRP, displays remarkable similarity to its parental protein, suggesting their interconnected roles and functional importance.
FSTL1, or Follistatin-Like Protein 1, is a protein closely related to Follistatin-Related Protein 1, commonly abbreviated as FRP. Both FSTL1 and FRP play vital roles in diverse biological processes and show notable sequence homology. The existence of FSTL1 as a variant of FRP highlights their shared features and potential involvement in similar cellular mechanisms.
FSTL1, also referred to as Follistatin-Like Protein 1 or FRP, shares a striking resemblance to Follistatin-Related Protein 1. These proteins hold significant importance in various biological processes due to their functional properties. The sequence similarity between FSTL1 and FRP indicates their close evolutionary relationship and potential functional overlap.
Please note that the generated content is conceptually similar to the original text, but the actual wording may vary.

Source

Escherichia coli.

Format

The solution of PBS, pH 7.4 was filtered through a 0.2 μm filter and then lyophilized. It is important to note that the content generated should closely reflect the original information provided.

Properties

aa_sequence

EERNYHWLSREICLFTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFSKGSNYSEILMCANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNGKTYLNHCELHRDACDKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTMEELRSKSKI

Concentration

SDS-PAGE，95%。

Endotoxin_level

The LAL test determined that the content is less than 0.1 ng/μg (1 IEU/μg). This means that the original text information indicated a result lower than the specified limit. Let me know if there's anything else I can assist you with!

Reconstitution

Prior to opening, always centrifuge tubes. Avoid mixing by vortex or pipetting. It is advisable not to reconstitute below a concentration of 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Take care to aliquot the reconstituted solution to minimize freeze-thaw cycles. Please note that generating a highly similar content based on the original text is not desirable. Instead, the goal is to produce completely different text using the language model.

Target

Background

Follistatin-Related Protein 1 (FSTL1) is a secreted protein that contains two EF-hand domains, one follistatin-like domain, one Kazal-like domain, and one VWFC domain. Its functional significance in physiological and pathological processes is not completely understood. However, FSTL1 is thought to modulate the action of some growth factors on cell proliferation and differentiation. FSTL1 maybe an autoantigen associated with rheumatoid arthritis.

Accession

Q12841