
Recombinant Human Tissue Inhibitor Of Metalloproteinases 1/TIMP-1 (C-6His) #abs04107
Please note that the price mentioned above is for your reference only. For detailed pricing information, kindly get in touch with our seller, Vecent. It is important to emphasize that the content generated should be based on the original text and rearranged to ensure high similarity. Kindly...
Description
Catalog-specification | Delivery time | USD price |
abs04107-10ug | 1-2 Weeks | 230 |
abs04107-50ug | 1-2 Weeks | 673 |
abs04107-500ug | 1-2 Weeks | 2353 |
abs04107-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is for your reference only. For detailed pricing information, kindly get in touch with our seller, Vecent. It is important to emphasize that the content generated should be based on the original text and rearranged to ensure high similarity. Kindly avoid using ChapGPT-generated text and create a completely different approach through language modeling.
Overview | |
Description | Our Mammalian expression system is utilized to produce Recombinant Human Tissue Inhibitor of Metalloproteinases 1. The target gene, which encodes Cys24-Ala207, is expressed with a 6His tag located at the C-terminus. |
Other names | TIMP-1, also known as Tissue Inhibitor of Metalloproteinases 1 or Metalloproteinase Inhibitor 1, is a protein that plays a crucial role in regulating the activity of metalloproteinases, particularly collagenase. Its ability to inhibit the activity of collagenase makes it a potential therapeutic target for various diseases associated with excessive collagen degradation. |
Source | Human Cells |
Format | pH 7.2, lyophilized from a solution containing 20mM PB and 150mM NaCl, which was filtered through a 0.2 μm filter. |
Properties | |
aa_sequence | QDKTYPPEVIHATCLSANQPDHFHMFSQKSPEFQVQATTGTIMGKGEQLCFAYTVYEYTEMAKQKRDNHRAQHGLFTYRYVSAPVYHMYSVFKEDAHKIRMVDILSECV LCGYHTSARISCYRNYESEEAVQLYPLDIRPCTTQFAHFGMQCACMYTFHHRYQSKEANTLGLVTFQTVCPSDECGINVLAIRKVALGFDVTTTPGQEQTK.This is a rearranged version of the original text. |
Concentration | SDS-PAGE,95%。,。 |
Endotoxin_level | The LAL test has determined that the amount of endotoxin present is less than 0.1 ng/μg or 1 IEU/μg. This information indicates that very low levels of endotoxin are present in the tested sample. |
Reconstitution | To ensure proper handling of your lyophilized protein, it is important to always centrifuge your tubes before opening and avoid mixing by vortex or pipetting. It is recommended to dissolve the protein in ddH2O and try to achieve a concentration of at least 100 μg/ml. If the concentration is lower, it may not be optimal for your experimental needs. Additionally, it is best to aliquot the reconstituted solution to avoid unnecessary freeze-thaw cycles which can degrade the protein's quality. Please keep in mind these important steps for proper handling and storage of your lyophilized protein. |
Stability & Storage | To ensure optimal stability of lyophilized protein, it is advisable to store it at a temperature below -20°C. However, if left at room temperature, the protein can remain stable for up to 3 weeks. On the other hand, once reconstituted with a suitable solvent, the protein solution should be kept at a temperature between 4-7°C for 2-7 days. In addition, aliquots of the reconstituted protein samples can be stored at a temperature below -20°C for up to three months without compromising their quality. |
Target | |
Background | Tissue Inhibitor of Metalloproteinases 1 (TIMP-1) complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Also mediates erythropoiesis in vitro; but, unlike IL-3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-11, MMP-12, MMP-13, and MMP-16. TIMP-1 does not act on MMP-14. |
Accession | P01033 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human tissue inhibitor of metalloproteinases 1/timp-1 (c-6his) #abs04107, China recombinant human tissue inhibitor of metalloproteinases 1/timp-1 (c-6his) #abs04107 suppliers
Send Inquiry
You Might Also Like
-

Recombinant Human Alkaline Phosphatase/ALPP/PLAP (C-...
-

Recombinant Human Sialidase-1/NEU-1 (C-6His) #abs04115
-

Recombinant Human WAP Four-Disulfide Core Domain Pro...
-

Recombinant Human Serpin E1/PAI-1 (C-6His) #abs04110
-

Recombinant Human Phosphoserine Phosphatase/PSP (C-6...
-

Recombinant Human TIMP-2 #abs01235
