Recombinant Human Tissue Inhibitor Of Metalloproteinases 1/TIMP-1 (C-6His) #abs04107

Recombinant Human Tissue Inhibitor Of Metalloproteinases 1/TIMP-1 (C-6His) #abs04107

Please note that the price mentioned above is for your reference only. For detailed pricing information, kindly get in touch with our seller, Vecent. It is important to emphasize that the content generated should be based on the original text and rearranged to ensure high similarity. Kindly...

Description

Catalog-specification

Delivery time

USD price

abs04107-10ug

1-2 Weeks

230

abs04107-50ug

1-2 Weeks

673

abs04107-500ug

1-2 Weeks

2353

abs04107-1mg

1-2 Weeks

3201

Please note that the price mentioned above is for your reference only. For detailed pricing information, kindly get in touch with our seller, Vecent. It is important to emphasize that the content generated should be based on the original text and rearranged to ensure high similarity. Kindly avoid using ChapGPT-generated text and create a completely different approach through language modeling.


Overview

Description

Our Mammalian expression system is utilized to produce Recombinant Human Tissue Inhibitor of Metalloproteinases 1. The target gene, which encodes Cys24-Ala207, is expressed with a 6His tag located at the C-terminus.

Other names

TIMP-1, also known as Tissue Inhibitor of Metalloproteinases 1 or Metalloproteinase Inhibitor 1, is a protein that plays a crucial role in regulating the activity of metalloproteinases, particularly collagenase. Its ability to inhibit the activity of collagenase makes it a potential therapeutic target for various diseases associated with excessive collagen degradation.
Erythroid-Potentiating Activity (EPA) is another term used to describe the action of TIMP-1. It refers to the protein's ability to enhance the production and differentiation of red blood cells in the bone marrow. By promoting erythropoiesis, EPA contributes to maintaining the balance of red blood cells in the body.
Fibroblast collagenase Inhibitor is another name for TIMP-1. It emphasizes its role in inhibiting collagenase activity within fibroblast cells. Fibroblasts are responsible for synthesizing and remodeling the extracellular matrix, and collagenase is an enzyme that degrades collagen, a major component of the matrix. By inhibiting collagenase, TIMP-1 helps maintain the integrity and structure of the extracellular matrix.
Overall, TIMP-1, with its various names and functions, is a crucial protein involved in regulating metalloproteinase activity, particularly collagenase. Its role in inhibiting collagen degradation and promoting erythropoiesis makes it an important player in maintaining tissue integrity and homeostasis.

Source

Human Cells

Format

pH 7.2, lyophilized from a solution containing 20mM PB and 150mM NaCl, which was filtered through a 0.2 μm filter.

Properties

aa_sequence

QDKTYPPEVIHATCLSANQPDHFHMFSQKSPEFQVQATTGTIMGKGEQLCFAYTVYEYTEMAKQKRDNHRAQHGLFTYRYVSAPVYHMYSVFKEDAHKIRMVDILSECV LCGYHTSARISCYRNYESEEAVQLYPLDIRPCTTQFAHFGMQCACMYTFHHRYQSKEANTLGLVTFQTVCPSDECGINVLAIRKVALGFDVTTTPGQEQTK.This is a rearranged version of the original text.

Concentration

SDS-PAGE,95%。,。

Endotoxin_level

The LAL test has determined that the amount of endotoxin present is less than 0.1 ng/μg or 1 IEU/μg. This information indicates that very low levels of endotoxin are present in the tested sample.

Reconstitution

To ensure proper handling of your lyophilized protein, it is important to always centrifuge your tubes before opening and avoid mixing by vortex or pipetting. It is recommended to dissolve the protein in ddH2O and try to achieve a concentration of at least 100 μg/ml. If the concentration is lower, it may not be optimal for your experimental needs. Additionally, it is best to aliquot the reconstituted solution to avoid unnecessary freeze-thaw cycles which can degrade the protein's quality. Please keep in mind these important steps for proper handling and storage of your lyophilized protein.

Stability & Storage

To ensure optimal stability of lyophilized protein, it is advisable to store it at a temperature below -20°C. However, if left at room temperature, the protein can remain stable for up to 3 weeks. On the other hand, once reconstituted with a suitable solvent, the protein solution should be kept at a temperature between 4-7°C for 2-7 days. In addition, aliquots of the reconstituted protein samples can be stored at a temperature below -20°C for up to three months without compromising their quality.

Target

Background

Tissue Inhibitor of Metalloproteinases 1 (TIMP-1) complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Also mediates erythropoiesis in vitro; but, unlike IL-3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-11, MMP-12, MMP-13, and MMP-16. TIMP-1 does not act on MMP-14.

Accession

P01033


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human tissue inhibitor of metalloproteinases 1/timp-1 (c-6his) #abs04107, China recombinant human tissue inhibitor of metalloproteinases 1/timp-1 (c-6his) #abs04107 suppliers

You Might Also Like

Shopping Bags