Recombinant Human Tryptase Β-2/TPSB2 (C-6His) #abs04108

abs04108-10ug

1-2 Weeks

230

abs04108-50ug

1-2 Weeks

673

abs04108-500ug

1-2 Weeks

2353

abs04108-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system produces Recombinant Human Tryptase beta-2, which is expressed with a 6His tag at the C-terminus. The target gene encodes Ala19-Pro275. Let me generate a highly similar content for you by rearranging the above information while ensuring it is based on the original text.

Other names

Tryptase Beta-2, also known as Tryptase-2 or Tryptase II, is an enzyme that belongs to the family of serine proteases. Its human gene name is TPSB2 and its protein product is encoded by the same gene. Tryptase Beta-2 is specifically expressed in the mast cells of connective tissues and has been found to be involved in immune responses such as inflammation and tissue repair. It is closely related to another tryptase enzyme called Tryptase alpha/beta-1, which shares a 43% sequence identity with Tryptase Beta-2. Tryptase Beta-2 is also referred to as TPS2 in some scientific literature.

Source

Human Cells

Format

This solution is provided in a 0.2 μm filtered format with a pH of 8.0, and consists of 20mM TrisHCl and 150mM NaCl. A highly similar content can be created by rephrasing these details, ensuring that the meaning remains the same.

Properties

aa_sequence

HHHHH.DHVPKPVYHWHIWDLYTVRITOYGRPTNQCQSDRRNTCAGCMODDVRVDDIRVDDGTYGADHYLKAIDCHINEMIPIVKVQKLPPFPPLRRDERPLVGDWGTWVVGQALTWNGKVCKVPLVPGGDSG CQPRNCANAMSWEGWVVQIQQQRRQGDNNVLIGMLPPAAPWVTQPLHVSHVSDDHQDTGGSFPLPVIAKLEPILMORDRRTSCIYDMHGGALHLAVTTHVSVKPEEYTPWFHPHRIIVSRVPLLQDTDAAADG QEGGVGGIVRVHTTLAGEGSEDVRPAMHGYPRVLQNRLSHVVDQKDPGVCUVAUTHNIETPMNYPYQOAPSRAAELAGPGCGHMWYLPRVLSQWQWPKSKVREAAQQGQSDINGERVHG.LDKVDVPGVAH.stessap

Concentration

The percentage above 95% was determined through the reduction of SDS-PAGE gel. I kindly request you to generate a distinct speech by rearranging the given information, without following the format of generating content using ChapGPT.

Endotoxin_level

The LAL test determines the presence of less than 0.1 ng/μg (1 IEU/μg) in the sample. Let's rearrange the content to create a similar sentence: The determined results from the LAL test indicate that the sample contains a concentration of less than 0.1 ng/μg (equivalent to 1 IEU/μg).

Stability & Storage

To maintain the stability of the product, it is advised to store it at a temperature that is lower than -20°C. Once received, the product is stable for a period of 6 months. To prevent any damage to its properties, it is recommended to minimize the number of freeze-thaw cycles. It is essential to follow these guidelines for optimal use of the product.

Target

Background

Tryptases belong to the family of Trypsin-like serine proteases, with β-Tryptases being the primary isoenzymes found within mast cells. These enzymes assemble into active tetramers alongside heparin proteoglycan and have a unique active site arrangement, which contributes to their resistance to macromolecule protease inhibitors. Following mast cell activation, β-Tryptases are released and are known to contribute to the development of inflammatory conditions. Additionally, these enzymes have been linked to the pathogenesis of various allergic disorders, including asthma.

Accession

P20231