Recombinant Human Serpin A12/Vaspin (N-GST) #abs04104

abs04104-10ug

1-2 Weeks

161

abs04104-50ug

1-2 Weeks

482

abs04104-500ug

1-2 Weeks

1879

abs04104-1mg

1-2 Weeks

2561

Description

Our E.coli expression system is utilized to produce Recombinant Human Serpin A12, where the target gene encoding Leu21-Lys414 is expressed with a GST tag at the N-terminus. Please generate content with a high degree of similarity to the original information provided while ensuring the rearrangement of the sentences.

Other names

Visceral adipose tissue-derived serine protease inhibitor, also known as Serpin A12, OL-64, Vaspin, or Visceral adipose-specific serpin, is a protein that plays a key role in metabolic regulation. This serine protease inhibitor is mainly secreted from visceral adipose tissue and functions as an insulin-sensitizing hormone. It has also been shown to have anti-inflammatory and anti-atherosclerotic effects.
Serpin A12 modulates insulin sensitivity by inhibiting proteases that degrade insulin receptor substrate-1, which is a central signaling molecule in the insulin signaling pathway. By doing so, it increases insulin sensitivity and glucose uptake in adipose tissue and skeletal muscle. Additionally, Serpin A12 inhibits the production of pro-inflammatory cytokines, such as TNF-α and IL-6, thereby reducing inflammation in adipose tissue.
Studies have shown that Vaspin levels are lower in individuals with insulin resistance, obesity, and type 2 diabetes, and that its expression is regulated by various factors, including nutritional status and physical activity. Vaspin has also been shown to have potential therapeutic use in metabolic disorders, such as obesity and diabetes.
In summary, Serpin A12/Vaspin is a novel adipokine that plays a crucial role in the regulation of metabolism, inflammation, and insulin sensitivity. Its potential therapeutic use in metabolic disorders makes it an attractive target for future research.

Source

Escherichia coli.

Format

pH7.20.2μm，50mM TrisHCl、160mM NaCl、0.2mM PMSF、1mM DTT、10%。，。

Properties

aa_sequence

LMKLGFWKRPKVRQMLEGYWNEEKLYLDLPTYEIPITRVNGEKDKIWFKLGLPENPYVYDGKKTQIS MARYARIYNHGKDIMKKGLPSCEAEFLMAISRGELVLDIYSVRSAYKFDSKTLVLDFKSLPKMEEL KMRDLFCHTYDGHLVTPDFMYLDALVVLKVWMDPMPCLYAFPKLVCKKRQIEIPAIDYLSKS YKIAWQGPPSWTAFGSDHDKPGSLVPNKVPRFSLKSGPSKLYANQMVQEWKKRQMAALRAKNFD LGKFLKKLAFFPNPGRILFSSTLISSTMSLCAFGDLEKISTQDEIKQGFNFRKMPEKDLHLGEHIFY TLEHQKDTQLKLIGSNILFTDRQLPFEKFRLADKNFYSAITILNQNFEMKAQLQIDFNISKTH QNHLKGIPNTEVLIIDGPFMLANYIFFFRWRAKEDFPNHKTEDEFYKLNSSVVPKMFYRSGYQGV KYDKSLCTILVIPYQNKAIFILPDEKLKGLEKHQVLTDSFRWTLRKTSLVRDVSPVVDSPGHMT GTFDKLKTYLSYKGVIIFHEEGDLTAKIHPRSLKVGEHAHKALEKMDERGGETGTAAAGQLTPMT TPKVIKDLLYYLIPSEKFPVSLIFLKGPVINKIGK.

Concentration

Reducing SDS-PAGE analysis determined that the protein purity reached a remarkable level exceeding 95%.

Endotoxin_level

The LAL test indicates that the level of endotoxin in the sample is less than 0.1 ng/μg (1 IEU/μg). This information suggests that the sample has a low level of contamination, making it suitable for further testing or use.

Stability & Storage

To maintain the stability of the product, it is recommended to store it at a temperature lower than -20°C, and it can be retained for six months after receipt. It is advised to reduce the number of freeze-thaw cycles to prevent any possible alteration in the properties of the product.

Target

Background

Vaspin, also known as Visceral Adipose-Specific SERPIN, is an emerging adipokine with unique characteristics. It possesses a structural arrangement consisting of three β-sheets, nine α-helices, and a central loop, which aligns it with other members of the Serpin family. Notably, in the realm of obesity, Vaspin stands out as an intriguing insulin sensitizing adipocytokine.
Recent research has shed light on the relationship between Vaspin and obesity-related parameters. Specifically, it has been observed that the expression of Vaspin mRNA in visceral fat is positively correlated with both body mass index (BMI) and the percentage of body fat. This correlation suggests that Vaspin might play a pivotal role in the context of obesity, insulin resistance, and glucose metabolism.
Such findings pave the way for potential clinical applications of Vaspin in addressing various manifestations commonly associated with the obesity metabolic syndrome. This new adipokine holds promise in ameliorating aberrations related to insulin resistance and glucose metabolism. By better understanding the intricate workings of Vaspin, researchers and clinicians may develop novel therapies and interventions targeting the multifaceted challenges posed by obesity and its associated complications.

Accession

Q8IW75