
Recombinant Human Matrix Metalloproteinase-3/MMP-3 (C-6His) #abs04106
Please note that the price mentioned above is only for your reference. If you require more detailed pricing information, please get in touch with our seller Vecent. We would be more than happy to assist you with any queries you may have. This product is for research use only, not for use in...
Description
Catalog-specification | Delivery time | USD price |
abs04106-10ug | 1-2 Weeks | 230 |
abs04106-50ug | 1-2 Weeks | 673 |
abs04106-500ug | 1-2 Weeks | 2353 |
abs04106-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is only for your reference. If you require more detailed pricing information, please get in touch with our seller Vecent. We would be more than happy to assist you with any queries you may have.
Overview | |
Description | Our Mammalian expression system yields Recombinant Human Matrix Metalloproteinase-3 with a 6His tag at the C-terminus. This form of the target gene, encoding Tyr18-Cys477, is identical to the original sequence and highly similar in function. Our production process ensures that our product is of the highest quality and meets the strictest standards for performance and purity. Order now to experience the exceptional quality of our recombinant protein. |
Other names | MMP-3, also known as Stromelysin-1 or Transin-1, is a matrix metalloproteinase enzyme encoded by the STMY1 gene. It is referred to by various other names such as SL-1 and MMP3. This enzyme plays a crucial role in the breakdown and remodeling of the extracellular matrix. By rearranging the given information, we can summarize that MMP-3, also called Stromelysin-1 or Transin-1, is a matrix metalloproteinase encoded by the STMY1 gene and commonly known as SL-1 or MMP3. Its primary function involves the degradation and restructuring of the extracellular matrix. |
Source | Human Cells |
Format | pH 7.5, 20mM TrisHCl, 150mM NaCl, 0.05% Brij35, and 10% Glycerol are combined to create a solution, which is then filtered through a 0.2 μm filter. This resulting solution contains all of these components in their specified concentrations, ensuring optimal conditions for whatever application it is intended for. |
Properties | |
aa_sequence | DVLQGDRFPSSKEMDVVFNLSKYRVQTLNYKDLEKDRGVDKMDRKEQIKRRLVEKKFLGKTDGG TLERKVGCGKVPHDGRPTFVGIPKRWGKTVYTHNRVPTDPLPKDAYDEVELAKKQVEWTVKLS PLESLFYRGMEVATDFASVHYGPFDGPFGPIGDWQDNKTRTMTFVLLAHIEF;EGRGGLGHLDSLHNSM ALSYRDTTLFDEQDINGQIKGSLYPPGIPDSETPVVPPEPGPTNACPLFDDSARLVTDLRGEIL IFKDRHFWRKSLRKLEPEHLSELISFSLPSGAVSDAYEVTFLDSFFIKGNQWRAIGVREPAGP YHFGIPTRKVIEDADIKETNKKTYFFVEDYWKERFDSMSNKPGEPQAFKIAEPFGPDSVIDAKEED EGFYFTFSSKNKKAVTLFDEKHHLCHCNWHNDVDHHHHHH. |
Concentration | The purity of the sample was found to be greater than 95% through the process of SDS-PAGE gel analysis. To produce a similar content, one could say that the sample's SDS-PAGE gel result showed that it had a purity level of over 95%. |
Endotoxin_level | The LAL test determined the presence of less than 0.1 ng/μg (1 IEU/μg) in the given sample. A highly similar content can be generated by rearranging the information as follows: The determined result of the LAL test for the sample indicated that it contained less than 0.1 ng/μg (1 IEU/μg). |
Stability & Storage | To maintain stability, it is recommended to store at a temperature below -20°C. Once received, the product can remain stable for up to six months. Avoid subjected to multiple freeze-thaw cycles to prevent deterioration of the product. To ensure optimal quality, please adhere to the storage and handling instructions. |
Target | |
Background | MMP3 is a vital element of the matrix metalloproteinase (MMP) family, which participates in various physiological processes such as embryonic development, tissue remodeling, and reproduction. The enzyme primarily functions in the breakdown of the extracellular matrix and is involved in the progression of arthritis, metastasis, and other diseases. MMP-3 has a wide range of substrates, such as collagen types II, III, IV, IX, and X, proteoglycans, fibronectin, laminin, and elastin, rendering it crucial in connective tissue remodeling. Moreover, MMP-3 can activate several other MMPs, including MMP-1, MMP-7, and MMP-9, thereby playing a pivotal role in many biological processes. The enzyme is also believed to contribute to the repair of injuries, development of atherosclerosis, and tumor initiation. |
Accession | P08254 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human matrix metalloproteinase-3/mmp-3 (c-6his) #abs04106, China recombinant human matrix metalloproteinase-3/mmp-3 (c-6his) #abs04106 suppliers
Send Inquiry
You Might Also Like






