Recombinant Human Serpin E1/PAI-1 (C-6His) #abs04110

abs04110-10ug

1-2 Weeks

230

abs04110-50ug

1-2 Weeks

673

abs04110-500ug

1-2 Weeks

2353

abs04110-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system is used to produce Recombinant Human Serpin E1/PAI-1, where the target gene that encodes Val24-Pro402 is expressed with a 6His tag at the C-terminus.

Other names

Serpin E1, also known as Plasminogen Activator Inhibitor 1 (PAI-1) or Endothelial Plasminogen Activator Inhibitor, is a protein encoded by the SERPINE1 gene. PAI-1 is a crucial inhibitor of plasminogen activation, an enzyme involved in blood clot dissolution. It plays a significant role in regulating the fibrinolytic system and maintaining the balance between clot formation and clot breakdown. PAI-1 is primarily produced and secreted by endothelial cells, contributing to its alternative name, Endothelial Plasminogen Activator Inhibitor. It has also been implicated in various physiological and pathological processes, including thrombosis, inflammation, tissue remodeling, and cancer progression. PLANH1 is the corresponding gene symbol for PAI-1.

Source

Human Cells

Format

The solution was filtered through a 0.2 μm filter and then lyophilized into a powder. It contained 20mM HAc-NaAc, 150mM NaCl, and had a pH of 4.0. This information can be used to recreate a similar content with slightly different wording.

Properties

aa_sequence

GVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFKVHHPPSYVAHLASDFGVRVFQQIDDKGMAPALRHLYKELFFEVEQRDLKLVQGFMPHFFRLFRSTVKQVDFSEVEISTTDAIFVIWNKDEGAVDQLTRLVLVNALYFNGQWKTPFPDSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYRARGISNILLILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKJPFLFVDLRKPLENLGMTDMFRQFQADFTSLSDQEPLHVAQALQKVKIEVNESGTVASSSTAVIVSARMAPEEIIMDRPHHHHHMGQVMEPLD.

Concentration

SDS-PAGE，95%。，。

Endotoxin_level

The LAL test has shown that the level of endotoxin in the sample is less than 0.1 ng/μg or 1 IEU/μg. This information is based on the original text and it has been rearranged in a different way to convey the same meaning.

Reconstitution

Tubes should always be centrifuged before opening. Avoid using vortex or pipetting to mix them. It is not advisable to reconstitute the protein to a concentration below 100 μg/ml. Start by dissolving the lyophilized protein in ddH2O. Remember to aliquot the reconstituted solution to minimize freeze-thaw cycles. To create a distinct piece of content, please generate a text using a different approach and style, based on the information provided above.

Stability & Storage

The recommended storage conditions for lyophilized protein are below -20°C. However, it can also be kept at room temperature for a period of three weeks without significant degradation. When reconstituted into a solution, the protein should be stored at a temperature range of 4-7°C, ideally for a duration of 2-7 days. If aliquots of the reconstituted samples are prepared, they can be safely stored below -20°C for up to three months, ensuring their stability over an extended period.

Target

Background

Serpins are a group of proteins with similar structures that were first identified as a set of proteins able to inhibit proteases. They are the largest and most diverse family of serine protease inhibitors which are involved in a number of fundamental biological processes such as blood coagulation, complement activation, fibrinolysis, angiogenesis, inflammation and tumor suppression and are expressed in a cell-specific manner. Serpin E1 is a secreted protein which belongs to the Serpin family. Serpin E1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis. Defects in SERPINE1 are characterized by abnormal bleeding due to Serpin E1 defect in the plasma. High concentrations of Serpin E1 have been associated with thrombophilia which is an autosomal dominant disorder in which affected individuals are prone to develop serious spontaneous thrombosis.

Accession

P05121