Recombinant Human Serpin F1/PEDF(C-6His) #abs04111

abs04111-10ug

1-2 Weeks

161

abs04111-50ug

1-2 Weeks

482

abs04111-500ug

1-2 Weeks

2353

abs04111-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system produces Recombinant Human Serpin F1/PEDF, which is expressed with a 6His tag at the C-terminus. The target gene encoding Gln20-Pro418 is utilized in the expression process to ensure maximum efficiency. This results in a highly pure and potent product that is identical to the original protein. We take great care in ensuring that the final product is highly similar to the original content, providing researchers with a reliable tool for their experiments.

Other names

PEDF, also known as Cell Proliferation-Inducing Gene 35 Protein or EPC-1, is a protein that belongs to the Serpin F1 family. It is a multifunctional protein that is widely expressed in different tissues and has been shown to have various biological activities. PEDF plays an important role in regulating cell proliferation, differentiation, and survival, and has been implicated in the pathogenesis of various diseases, such as cancer and diabetes.
Studies have shown that PEDF can inhibit the proliferation of many types of cells, including endothelial, epithelial, and neuronal cells. It can also induce differentiation and promote cell survival. PEDF has been shown to possess anti-angiogenic, anti-tumor, and anti-inflammatory properties, making it a potential therapeutic agent for the treatment of various diseases.
In addition, PEDF has been shown to play an important role in the regulation of glucose and lipid metabolism. It can improve insulin sensitivity and glucose uptake in adipose tissue, muscle, and liver. PEDF has also been found to regulate lipid metabolism by inhibiting lipolysis in adipose tissue and reducing hepatic triglyceride synthesis.
Overall, PEDF is a multifunctional protein that plays an important role in regulating cell proliferation, differentiation, and survival, as well as glucose and lipid metabolism. Its diverse biological activities make it a promising target for the development of novel therapeutic agents for the treatment of various diseases.

Source

Human Cells

Format

After being filtered through a 0.2 μm filter, a solution containing 20mM TrisHCl and 150mM NaCl at pH 8.0 was lyophilized. To create similar content, this statement can be rephrased as: The lyophilization process involved a 0.2 μm filtered solution with a pH of 8.0 consisting of 20mM TrisHCl and 150mM NaCl.

Properties

aa_sequence

SPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSQNPASPPEEG VATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLR IKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFK GQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLP LKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFS KITGKPIKLTQVEHRAGFEWNEDGAAVSNFGYDLYRVRSSTSPTTNVLLSPLSPPFIFVLRDTDT GALLFIGKILDPRGPVDHHHHHHSPDPDSTGALVEEEDPFFKVPVNKLAAALSKLKLSYEGEVT.
Reordered version:
SPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLS
QNPASPPEEGVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKL
KLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAAVSNFGYDLYRVRSSTSPTTNVLLSPLSPPFIFVLRDTDTGALLFIGKILDPRGPVDHHHHHH

Concentration

The SDS-PAGE analysis indicated that the protein purity is greater than 95%. A highly comparable statement can be crafted by rearranging the information from the original text.

Endotoxin_level

The results of the LAL test indicate that the concentration is below 0.1 ng/μg (1 IEU/μg).

Reconstitution

To ensure accuracy and prevent contamination, it is advised to always centrifuge tubes before opening instead of using vortex or pipetting methods for mixing. Also, it is not recommended to reconstitute the protein to a concentration lower than 100 μg/ml. Dissolve the lyophilized protein in ddH2O and consider aliquoting the reconstituted solution to minimize freeze-thaw cycles. This will help maintain the quality and stability of the protein. Remember to always handle the lyophilized protein with care and follow the manufacturer's instructions for best results.

Stability & Storage

To ensure proper storage of lyophilized protein, it is advisable to keep it at a temperature of less than -20°C. However, it can be stored at room temperature for up to 3 weeks without any degradation in quality. Once the protein is reconstituted, it is best to store the solution in the refrigerator, within the range of 4-7°C, for a period of 2-7 days. For longer storage of reconstituted protein, it is recommended to aliquot and store at less than -20°C for up to 3 months. Proper storage of lyophilized protein and reconstituted protein solution ensures the stability and quality of the sample.

Target

Background

Serpin F1 is a secreted glycoprotein that belongs to the noninhibitory serpin. It has an alpha/beta core serine-protease inhibitor domain, three major beta-sheets, and ten alpha-helices. As protease inhibitors, serpins have an array of functions including regulating blood clotting, the complement pathway, extracellular matrix remodeling, and cell motility. They are also involved in activities that extend beyond their ability to inhibit proteases. For instance, they may also regulate blood pressure, angiogenesis, or act as storage/transport proteins. Serpin F1 is a new promising approach for the treatment of osteosarcoma and has been described as a natural angiogenesis inhibitor with neurotrophic and immune-modulation properties. The human serpin superfamily consists of at least 35 members that target not only serine proteases, but also selected cysteine proteases and non-protease proteins. Levels of the natural ocular anti-angiogenic factor SentrinF1 (PEDF) is associated with proliferative retinopathy.

Accession

P36955