Recombinant Human WAP Four-Disulfide Core Domain Protein 2/WFDC2 (C-6His) #abs04112

abs04112-10ug

1-2 Weeks

161

abs04112-50ug

1-2 Weeks

482

abs04112-500ug

1-2 Weeks

2353

abs04112-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system is used to produce Recombinant Human WFDC2. The target gene, which encodes Glu31-Phe124, is expressed with a 6His tag at the C-terminus. To generate a highly similar content, the rearranged version would be: The production of Recombinant Human WFDC2 relies on our Mammalian expression system. This system expresses the target gene with a 6His tag at the C-terminus, and it specifically encodes Glu31-Phe124.

Other names

HE4, WFDC2, WAP5, Epididymal Secretory Protein E4, Major Epididymis-Specific Protein E4, WAP Four-Disulfide Core Domain Protein 2, Putative Protease Inhibitor WAP5.
The protein known as WAP Four-Disulfide Core Domain Protein 2, also referred to as WFDC2 or HE4, is a major epididymis-specific protein E4. It is also commonly known as WAP5 or Putative Protease Inhibitor WAP5. This protein plays a significant role in various physiological processes.
HE4, WFDC2, WAP5, Epididymal Secretory Protein E4, Major Epididymis-Specific Protein E4, and WAP Four-Disulfide Core Domain Protein 2 are all different names used to describe this protein. It is primarily secreted by the epididymis, an organ found in the male reproductive system.
The WFDC2 protein is of particular interest due to its potential as a protease inhibitor. Studies have indicated that it may play a crucial role in regulating protease activity in the reproductive tract. Its inhibitory properties suggest that it could be involved in protecting the male reproductive system from excessive protease activity.
The WAP Four-Disulfide Core Domain Protein 2, WFDC2, or HE4 is also known for its association with certain clinical conditions. Elevated levels of this protein have been observed in patients with ovarian cancer, making it a potential biomarker for detecting and monitoring the disease.
Overall, the protein referred to as WAP5, Major Epididymis-Specific Protein E4, or Putative Protease Inhibitor WAP5 is a fascinating molecule with various names and functions. Its presence in the epididymis, as well as its association with protease regulation and ovarian cancer, make it a subject of ongoing scientific research.

Source

Human Cells

Format

The pH 7.2 solution was filtered through a 0.2 μm membrane and then lyophilized. It contained a mixture of 20mM PB and 150mM NaCl. To obtain the lyophilized product, the solution was freeze-dried to remove all the water. The original content provides information about the preparation method and the composition of the lyophilized sample.

Properties

aa_sequence

CRD QCQVDSQCPGQMKCCRNGCGKVSCVTPNFVDHHHHHH EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCVDSGCQCPQQDCRLKFNCINCTNQDSNSVNPKILGITCP++++

Concentration

According to SDS-PAGE analysis, the purity of the sample is more than 95%. To rephrase, the sample has been determined to possess a level of purity higher than 95% through analysis using SDS-PAGE.

Endotoxin_level

The LAL test determined that the concentration is below 0.1 ng/μg (1 IEU/μg). Let's create a similar content by rearranging the provided information.

Reconstitution

It is highly advisable to centrifuge the tubes before opening them. Avoid mixing through vortex or pipetting methods. Reconstituting the protein to a concentration lower than 100 μg/ml is not recommended. Begin by dissolving the lyophilized protein in ddH2O. To prevent excessive freeze-thaw cycles, it is suggested to divide the reconstituted solution into smaller aliquots. Please note that the requested content should be significantly different from the original text.

Stability & Storage

The storage conditions for lyophilized protein are important to maintain its stability. Ideally, it should be stored at temperatures below -20°C. However, if necessary, it can be stored at room temperature for a limited period of 3 weeks without significant degradation.
On the other hand, once the protein is reconstituted into a solution, it requires different storage conditions. The reconstituted protein solution should be stored at a cooler temperature between 4-7°C. Under these conditions, it can remain stable for a timeframe of 2-7 days.
To enhance its longevity, it is advisable to divide the reconstituted protein solution into smaller aliquots and store them at a temperature below -20°C. This way, the stability of the protein can be prolonged up to 3 months.
In summary, lyophilized protein should be kept at temperatures below -20°C, but it can also endure room temperature for up to 3 weeks. Whereas, once reconstituted, the protein solution is better preserved at 4-7°C for a shorter period of 2-7 days. For extended storage, it is recommended to freeze aliquots of the reconstituted protein at temperatures below -20°C for up to 3 months.

Target

Background

WAP Four-Disulfide Core Domain Protein 2 (WFDC2) is a 25 kDa secreted glycoprotein containing two WAP domains. Mature human WFDC2 is 94 amino acids (aa) in length. It contains two WAP domains that likely mediate antiprotease and/or antimicrobial activity (aa 31 - 73 and 74 - 123). There are four potential splice variants. One shows a deletion of aa 27-74, while three others show aa substitutions: 28 aa for aa 75-124, 23 aa for aa 1 - 74, and 10 aa for aa 71-124. WFDC2 is a member of a family of stable 4-disulfide core proteins that are secreted at high levels. It is expressed by a wide variety of epithelial cells, including respiratory epithelium, salivary gland mucous cells, breast duct epithelium, distal tubule renal epithelium, and epididymal epithelium. WFDC2 may be a component of the innate immune defences of the lung, nasal and oral cavities and suggest that WFDC2 functions in concert with related WAP domain containing proteins in epithelial host defence. WFDC2 re-expression in lung carcinomas may prove to be associated with tumour type and should be studied in further detail. Mammary gland expression of tammar WFDC2 during the course of lactation showed WFDC2 was elevated during pregnancy, reduced in early lactation and absent in mid-late lactation. WFDC2 can undergo a complex series of alternative splicing events that can potentially yield five distinct WAP domain containing protein isoforms.

Accession

Q14508