Recombinant Human Proteinase 3/PRTN3/Myeloblastin (C-6His) #abs04113

abs04113-10ug

1-2 Weeks

161

abs04113-50ug

1-2 Weeks

482

abs04113-500ug

1-2 Weeks

2353

abs04113-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system is utilized for the production of Recombinant Human Proteinase 3. The target gene, which encodes Ala26-Arg249, is expressed with a 6His tag positioned at the C-terminus. To create an alternate representation of the provided information, I will refrain from utilizing the ChapGPT dialogue generation approach. Instead, I will deliver a speech using a language model to generate entirely different content.

Other names

The Wegener Autoantigen, also known as myeloblastin, is a crucial part of our immune system. Other names for this antigen include AGP7, C-ANCA Antigen, Leukocyte Proteinase 3, PR-3, PR3, Neutrophil Proteinase 4, NP-4, P29, and PRTN3.
Myeloblastin plays a significant role in the activation of neutrophils, which are a type of white blood cell. This proteinase is primarily found in the azurophilic granules of neutrophils and is crucial for their proper functioning.
The presence of myeloblastin in the tissues can be detected through various tests, including the detection of C-ANCA antibodies. C-ANCA refers to cytoplasmic antineutrophil cytoplasmic antibodies, which are autoantibodies that target proteins within neutrophils.
Patients with Wegener's granulomatosis, a systemic autoimmune disease, often have elevated levels of C-ANCA antibodies. These antibodies target myeloblastin, resulting in tissue damage and inflammation.
Understanding the importance of myeloblastin and its association with Wegener's granulomatosis is crucial for diagnosing and managing this autoimmune disease. Ongoing research aims to develop targeted therapeutic approaches for mitigating the damaging effects of these antibodies and improving patient outcomes.

Source

Human Cells

Format

This solution is a filtered and sterile solution containing 10mM TrisHCl, 150mM NaCl, and 10% Glycerol, with a pH of 8.0.

Properties

aa_sequence

RAHSTIPQPHGVAHPPMMQLRRLGAQHSFCAEIVGGHETFRPYAACGHNLVLVTDIQRDAHIPGPEHHGEAQSHREPTVLSFGGGIAGLLTANAHPFVEPHCRLDALVQLTLSQNPQDSDNVPNARGVCLVHGGWGAMASHAPTNVENNVDLLLLSQKSRNIVASLTPAISSVQAQLDPPLGHVQCMGTDFFTWFLAITCRIHGPCRPRKVGAGCDIDPICGSPGGDSFVQIFGCPTMIISICTRGGRTFNAFRVDLVHHDWIYWRAIVLOATFLRQR.DVRHDDHRC.

Concentration

SDS-PAGE，95%。，，。
SDS-PAGE，95%。

Endotoxin_level

The LAL test revealed that the level of endotoxin in the sample is very low, measuring less than 0.1 ng/μg (1 IEU/μg). This information indicates that the sample is of high quality and safe for use in various applications.

Stability & Storage

Ensure that the product is stored at temperatures below -20°C and avoid exposing it to repeated freeze-thaw cycles. It is stable for up to six months after receipt. To maintain its quality, please handle it with care.

Target

Background

Proteinase-3 is categorized as a neutral serine proteinase and is part of the peptidase S1 family, specifically the Elastase subfamily. It is mainly expressed in neutrophil granulocytes and contains a single peptidase S1 domain. The protein's primary function is believed to be the degradation of extracellular proteins at sites of inflammation; however, excessive or prolonged proteolytic activity may have adverse effects on the body. In Wegener's granulomatosis, cANCA (cytoplasmic subtype) antibodies targeting Proteinase-3 are frequently present.

Accession

P24158