Recombinant Human Serpin H1 (C-6His) #abs04114

abs04114-10ug

1-2 Weeks

230

abs04114-50ug

1-2 Weeks

673

abs04114-500ug

1-2 Weeks

2353

abs04114-1mg

1-2 Weeks

3201

Description

Serpin H1，Ala19-Leu418，C-6His。，。

Other names

Serpins H1 and H2 are heat shock proteins that play a crucial role in collagen biosynthesis. Serpin H1, also known as 47 kDa heat shock protein, collagen-binding protein or colligin, is involved in the proper folding of procollagen in the endoplasmic reticulum. Meanwhile, Serpin H2, also called as cell proliferation-inducing gene 14 protein, helps regulate the degradation of type I collagen in the extracellular matrix.
Arsenic-transactivated protein 3, or AsTP3, is a protein that is upregulated in response to arsenic exposure. It is thought to be involved in the detoxification of arsenic by facilitating its transport across the cell membrane.
Another protein that is important in cell proliferation is the rheumatoid arthritis-related antigen RA-A47. This protein has been implicated in the pathogenesis of inflammatory diseases such as rheumatoid arthritis, and may play a role in regulating the immune response.
Overall, these proteins are involved in a wide range of cellular processes, and their dysregulation can have significant consequences for human health. Further study of their functions and mechanisms of action may ultimately lead to the development of new therapeutic approaches for a variety of diseases.

Source

Human Cells

Format

The solution was filtered through a 0.2μm sieve and then lyophilized. The composition of the solution before lyophilization was 20mM PB, 150mM NaCl, and a pH of 7.2. Please make sure that the generated content is closely similar to the original text by rearranging the information presented. However, refrain from using ChapGPT to create the content and instead use a language model to produce a unique speech.

Properties

aa_sequence

SPAAAKKLTKVTEALSGQLRAEKPELKASFAVLGQYMALQDNEVENILVSPVAVCSSLGVLVSGG KATSAQAALAVKTAERSDSLHEGVRLALEGLLRSLSSATNVWKLGSRYPGPVSVSADDFVRSSKQ HYCNEHSKINRFDRKLTALQSINEWAQTTTGKLPEVTKDVERTDGVILVNAMFFFPHWKEDF HHKMVDNRGFMVTRSYTVGVMMMHRTGYLNYYDDEEEKLQIVEMPKAHLLSLIVLPHHVEPLERL EKTLTKEQLKIWMGKMQKAVAKSILPKGVVEVTHDLQKHLAGLGTEAIKDNKADLSRSMGKDKD LYLASVFHTAAFELDTDGNPFDDQIYGREELRSPKLYFYADHPFIFLVRDTQSGSLLFIGRLVR PKGDKMRDELVDHHHHHHSS.

Concentration

As established through SDS-PAGE analysis, the protein concentration is above 95%. I would like to produce a similar content, but in a significantly different manner, without using the method employed by ChatGPT to generate content.

Endotoxin_level

The LAL test determined the presence of less than 0.1 ng/μg (1 IEU/μg) in the sample. Let's rearrange the content and generate a highly similar version: "According to the results of the LAL test, the detected amount of the substance was below 0.1 ng/μg (1 IEU/μg)."

Reconstitution

To ensure optimal results, it is important to properly handle the lyophilized protein before use. Prior to opening the tubes, always centrifuge them to ensure an even distribution of the contents. Avoid using vortex or pipetting methods when mixing, as they can lead to unwanted denaturation or damage to the protein. It is best to reconstitute to a concentration of at least 100 μg/ml, as concentrations lower than this may compromise assay accuracy or specificity. To reconstitute, simply dissolve the protein in ddH2O. To extend shelf life and maintain protein integrity, it is recommended to aliquot the reconstituted solution and avoid repeated freeze-thaw cycles. These simple steps can help ensure consistent and reliable results for your experiments.

Stability & Storage

When it comes to storing lyophilized protein, it's best to keep it at a temperature of less than -20°C. However, if you need to store it at room temperature, it can last for up to three weeks. For reconstituted protein solutions, you should keep them stored between 4-7°C for a period of 2-7 days. If you need to store aliquots of reconstituted samples, it's best to keep them at a temperature of less than -20°C for up to three months. By following these storage guidelines, you can ensure that your protein remains stable and effective for any necessary use.

Target

Background

Serpin H1 is a serine proteinase inhibitors Which belongs to the serpin family. Serpin H1 is induced by heat shock. Serpin H1 localizes to the endoplasmic reticulum lumen and binds specifically to collagen. Thus it is thought to be a molecular chaperone involved in the maturation of collagen molecules. Autoantibodies to this protein have been found in patients with rheumatoid arthritis. Serpin H1 may be a marker for cancer and nucleotide polymorphisms in this gene may be associated with preterm birth caused by preterm premature rupture of membranes.

Accession

P50454