
Recombinant Human Sialidase-1/NEU-1 (C-6His) #abs04115
Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller, Vecent. This product is for research use only, not for use in diagnostic prodecures or in human.
Description
Catalog-specification | Delivery time | USD price |
abs04115-10ug | 1-2 Weeks | 230 |
abs04115-50ug | 1-2 Weeks | 673 |
abs04115-500ug | 1-2 Weeks | 2353 |
abs04115-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller, Vecent.
Overview | |
Description | Our Mammalian expression system is responsible for producing Recombinant Human Sialidase-1. The target gene, which encodes Glu48-Leu415, is expressed with a 6His tag at the C-terminus. |
Other names | 1. Acetylneuraminyl Hydrolase, also known as Sialidase-1, G9 Sialidase, Lysosomal Sialidase, N-Acetyl-Alpha-Neuraminidase 1, NEU1, or NANH, is an enzyme involved in the hydrolysis of acetylneuraminyl residues. |
Source | Human Cells |
Format | The solution provided is a filtered solution containing 20mM PB, 150mM NaCl, and 10% glycerol, with a pH value of 7.4. It is important to note that the generated content is based on the original text information but arranged in a highly similar manner. |
Properties | |
aa_sequence | LLSUQMELPLFVQEGLWDIRTIGGSQIVFTDVPTAGTILPLRAEKSMAGKDEASFIFLSRRDSQ TGSWPSTAFIVVDGGLNLVPGVVDVETGVVFLFSYLACHCVQSTAMWVSKDGNSWSSWPRTLIGF AGPGSGIQKQREPLKRRGCIVCLHGTLERDGVFCLLDASHGASWRYGGVSGIPYGQPKQENFD PCEQDNPYELPDGVVYINRQNNNHCYCHCRIVLRDTDACLRPDVTFDPELVAGIIVTSSGIFFS NPAHPEFRVNLTLRWSFSNGTSWKQETVRLWPGPSGYSLSLEATLDMGEEQAPQLYVLYKHRYNH TESIVSAKGVHHHHHHHLVDTFLIKEQGSPVQAPMGIAARTSAGWTFRSDVGVAIFPLLTQPLQE KLWVRQSGGISTIDPTVAFATGILSVRPLKDKAGMEFISLSRQDQGSTWTSTPYFIVNDGDVPDG VAVGVITDYLVDFLAYERCHKVQCAMVLVWSRQWDGIPARYSFDVGSTFYSLAAGQKIPSCALLQ GGKMDAQEPVIVWPYLSFYLNVLKIENLNEMNPQTEKLLAFSYNNDGGRWALTKYKPDRELPKP IDSLVQMKLMNLKLQKHLFIEFLYYLPVQEMMMIMVFLQVQDLERINGLQQQGQQQGQQQGQQQ GQQQQPQK. |
Concentration | SDS-PAGE analysis revealed that the protein concentration exceeds 95%, surpassing our expectations. |
Endotoxin_level | The level of endotoxin in the sample is extremely low, measuring less than 0.1 ng/μg (equivalent to 1 IEU/μg) when analyzed through a LAL test. |
Stability & Storage | To ensure its stability, keep the product stored at temperatures below -20°C, and it will remain stable for six months after you receive it. However, try to minimize the number of times you freeze and thaw it to maintain its quality. |
Target | |
Background | Sialidase-1, a member of the N-acetyl-a neuraminidase family, is widely expressed in various tissues. Interestingly, its expression is particularly high in the pancreas but relatively weak in the brain. Functioning as a lysosomal enzyme, Sialidase-1 plays a critical role in the cleavage of terminal sialic acid residues from molecules like glycoproteins and glycolipids. Any deficiencies in this vital enzyme can result in the development of sialidosis, an extremely rare lysosomal storage disease. |
Accession | Q99519 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human sialidase-1/neu-1 (c-6his) #abs04115, China recombinant human sialidase-1/neu-1 (c-6his) #abs04115 suppliers
Send Inquiry
You Might Also Like
-

Recombinant Human Proteinase 3/PRTN3/Myeloblastin (C...
-

Recombinant Human Serpin F1/PEDF(C-6His) #abs04111
-

Recombinant Human Serpin E1/PAI-1 (C-6His) #abs04110
-

Recombinant Human Serpin A1/alpha-1-Antitrypsin (C-6...
-

Recombinant Human Matrix Metalloproteinase-3/MMP-3 (...
-

Recombinant Human Phosphoserine Phosphatase/PSP (C-6...
