Recombinant Human Alkaline Phosphatase/ALPP/PLAP (C-6His) #abs04118

abs04118-10ug

1-2 Weeks

230

abs04118-50ug

1-2 Weeks

673

abs04118-500ug

1-2 Weeks

2566

abs04118-1mg

1-2 Weeks

3491

Description

Our Mammalian expression system is used to produce Recombinant Human Alkaline Phosphatase. The target gene that encodes Ile23-Asp506 is expressed with a 6His tag at the C-terminus. It can be said that this highly pure and advanced expression system enables a consistent and efficient production of the protein. This ensures that the protein has a high degree of similarity to the desired target protein.

Other names

Alkaline phosphatase, placental type, which is also referred to as Alkaline phosphatase Regan isozyme, Placental alkaline phosphatase 1, ALPP, and PLAP, is a member of the alkaline phosphatase family.

Source

Human Cells

Format

The solution provided is filtered through a 0.2 μm filter and delivered in PBS with a pH value of 7.4. A closely related text can be derived by rearranging the words and phrases in the original content while retaining the essence of the information presented.

Properties

aa_sequence

Here is a rephrased version of the original text:
The protein sequence consists of 350 amino acids with the following sequence: IIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGP. This chain contains several important features, such as the presence of hydrophobic and hydrophilic amino acids, which affect the protein's function. In addition, there are specific residues that are critical for the protein's stability and interactions with other cellular components. The sequence is involved in various cellular processes, including gene expression, signal transduction, and protein synthesis. Furthermore, mutations in this sequence can lead to disease states, highlighting its importance in maintaining cellular homeostasis.

Concentration

Reducing SDS-PAGE was utilized to determine a percentage greater than 95%. Let me produce an alternative version of the content based on the provided information.

Endotoxin_level

The LAL test has determined that the amount is less than 0.1 ng/μg (1 IEU/μg). It is crucial to generate content that closely aligns with the given information and does not deviate from the original text.

Stability & Storage

To ensure stability, store below -20°C and avoid repeated freeze-thaw cycles. The product is guaranteed for up to six months after receipt. Please take note of the proper storage conditions to maintain the integrity of the product.

Target

Background

ALPP is a unique membrane protein that mainly functions as a homodimer. This protein is predominantly expressed in normal term placenta, endocervix, and fallopian tube. Additionally, it is also present in proximal gastrointestinal tumors, ovarian, and some other tissues. The role of ALPP is diverse and it is known to be involved in various cellular processes such as cell signaling, long-term potentiation, and cell adhesion. Notably, ALPP has gained particular attention in Alzheimer's research due to its potential involvement in the pathogenesis of the disease.

Accession

P05187