
Recombinant Human Elafin/Trappin-2 (C-6His) #abs04117
Please note that the price provided is for your reference only. For detailed pricing information, please contact our seller Vecent. We understand that accurate pricing information is crucial for making informed decisions, and we want to ensure that you have all the information you need to make...
Description
Catalog-specification | Delivery time | USD price |
abs04117-10ug | 1-2 Weeks | 230 |
abs04117-50ug | 1-2 Weeks | 673 |
abs04117-500ug | 1-2 Weeks | 2353 |
abs04117-1mg | 1-2 Weeks | 3201 |
Please note that the price provided is for your reference only. For detailed pricing information, please contact our seller Vecent. We understand that accurate pricing information is crucial for making informed decisions, and we want to ensure that you have all the information you need to make the best choice for your needs. Our seller Vecent is available to answer any questions you may have and provide you with a detailed breakdown of costs. Don't hesitate to reach out to them for more information.
Overview | |
Description | Our Mammalian expression system is responsible for producing Recombinant Human Elafin. The gene we target is responsible for encoding Ala23-Gln117, and it is expressed with a 6His tag located at the C-terminus. To reiterate, we use our Mammalian expression system to generate Recombinant Human Elafin, wherein the target gene carrying Ala23-Gln117 is expressed with a 6His tag at the C-terminus. |
Other names | WAP Four-Disulfide Core Domain Protein 14, also known as Elafin, is a peptidase inhibitor that specifically targets elastase. It is commonly referred to as Elastase-Specific Inhibitor or ESI. Another name for this inhibitor is Peptidase Inhibitor 3 or PI-3. It is also known as Protease inhibitor WAP3 or WAP3. Moreover, it is sometimes called Skin-Derived Antileukoproteinase or SKALP. Overall, these different names refer to the same protein, which belongs to the WAP family of protease inhibitors. |
Source | Human Cells |
Format | The solution available is a filtered solution with a pore size of 0.2 μm and comprises TrisHCl in a concentration of 20mM along with NaCl at a concentration of 150mM. The pH of the solution, as measured, is 7.5. |
Properties | |
aa_sequence | APVKGQPVKGQDLKGRVPFNGQDPVGAVTGVPVSGQTVKAQEPVKGNPSTKPGSCQDVCZLCAMILN PPNRCLKDTDCPGIKKCCEGSCGMACFVPQVDHHHHHHCCEG. |
Concentration | To determine a protein's purity using SDS-PAGE, it is crucial to achieve a level greater than 95%. Thus, it is essential to perform the necessary steps and optimizations to ensure the highest possible purity. |
Endotoxin_level | The LAL test determined that the amount of endotoxins present is less than 0.1 ng/μg (1 IEU/μg). A content with similar information can be generated by rephrasing the original text, making sure that the context and meaning are preserved. |
Stability & Storage | -20°C,6。。 |
Target | |
Background | Elafin, a protein that is secreted, contains two distinct domains: the transglutaminase substrate domain, also known as cementoin moiety, and the elastase inhibitor domain. The primary function of the transglutaminase substrate domain is to serve as an anchor and secure Elafin to specific locations on extracellular matrix proteins through covalent bonds. Interestingly, recent findings highlight Elafin's potential as a biomarker for skin graft versus host disease. Notably, Elafin is synthesized and expressed in the skin during the process of wound healing, a mechanism activated through the epidermal growth factor receptor. It is believed that Elafin's presence may effectively inhibit and prevent elastase-induced tissue proteolysis, thus aiding in the preservation of tissue structure and integrity. |
Accession | P19957 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human elafin/trappin-2 (c-6his) #abs04117, China recombinant human elafin/trappin-2 (c-6his) #abs04117 suppliers
Send Inquiry
You Might Also Like
-

Recombinant Human Serpin H1 (C-6His) #abs04114
-

Recombinant Human Serpin E1/PAI-1 (C-6His) #abs04110
-

Recombinant Human Serpin A1/alpha-1-Antitrypsin (C-6...
-

Recombinant Human Tryptase Β-2/TPSB2 (C-6His) #abs04108
-

Recombinant Human Matrix Metalloproteinase-2/MMP-2 (...
-

Recombinant Human Phosphoserine Phosphatase/PSP (C-6...
