Recombinant Human Elafin/Trappin-2 (C-6His) #abs04117

Recombinant Human Elafin/Trappin-2 (C-6His) #abs04117

Please note that the price provided is for your reference only. For detailed pricing information, please contact our seller Vecent. We understand that accurate pricing information is crucial for making informed decisions, and we want to ensure that you have all the information you need to make...

Description

Catalog-specification

Delivery time

USD price

abs04117-10ug

1-2 Weeks

230

abs04117-50ug

1-2 Weeks

673

abs04117-500ug

1-2 Weeks

2353

abs04117-1mg

1-2 Weeks

3201

Please note that the price provided is for your reference only. For detailed pricing information, please contact our seller Vecent. We understand that accurate pricing information is crucial for making informed decisions, and we want to ensure that you have all the information you need to make the best choice for your needs. Our seller Vecent is available to answer any questions you may have and provide you with a detailed breakdown of costs. Don't hesitate to reach out to them for more information.


Overview

Description

Our Mammalian expression system is responsible for producing Recombinant Human Elafin. The gene we target is responsible for encoding Ala23-Gln117, and it is expressed with a 6His tag located at the C-terminus. To reiterate, we use our Mammalian expression system to generate Recombinant Human Elafin, wherein the target gene carrying Ala23-Gln117 is expressed with a 6His tag at the C-terminus.

Other names

WAP Four-Disulfide Core Domain Protein 14, also known as Elafin, is a peptidase inhibitor that specifically targets elastase. It is commonly referred to as Elastase-Specific Inhibitor or ESI. Another name for this inhibitor is Peptidase Inhibitor 3 or PI-3. It is also known as Protease inhibitor WAP3 or WAP3. Moreover, it is sometimes called Skin-Derived Antileukoproteinase or SKALP. Overall, these different names refer to the same protein, which belongs to the WAP family of protease inhibitors.

Source

Human Cells

Format

The solution available is a filtered solution with a pore size of 0.2 μm and comprises TrisHCl in a concentration of 20mM along with NaCl at a concentration of 150mM. The pH of the solution, as measured, is 7.5.

Properties

aa_sequence

APVKGQPVKGQDLKGRVPFNGQDPVGAVTGVPVSGQTVKAQEPVKGNPSTKPGSCQDVCZLCAMILN PPNRCLKDTDCPGIKKCCEGSCGMACFVPQVDHHHHHHCCEG.

Concentration

To determine a protein's purity using SDS-PAGE, it is crucial to achieve a level greater than 95%. Thus, it is essential to perform the necessary steps and optimizations to ensure the highest possible purity.

Endotoxin_level

The LAL test determined that the amount of endotoxins present is less than 0.1 ng/μg (1 IEU/μg). A content with similar information can be generated by rephrasing the original text, making sure that the context and meaning are preserved.

Stability & Storage

-20°C,6。。

Target

Background

Elafin, a protein that is secreted, contains two distinct domains: the transglutaminase substrate domain, also known as cementoin moiety, and the elastase inhibitor domain. The primary function of the transglutaminase substrate domain is to serve as an anchor and secure Elafin to specific locations on extracellular matrix proteins through covalent bonds. Interestingly, recent findings highlight Elafin's potential as a biomarker for skin graft versus host disease. Notably, Elafin is synthesized and expressed in the skin during the process of wound healing, a mechanism activated through the epidermal growth factor receptor. It is believed that Elafin's presence may effectively inhibit and prevent elastase-induced tissue proteolysis, thus aiding in the preservation of tissue structure and integrity.

Accession

P19957


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human elafin/trappin-2 (c-6his) #abs04117, China recombinant human elafin/trappin-2 (c-6his) #abs04117 suppliers

You Might Also Like

Shopping Bags