Recombinant Human Syndecan-1/SDC1/CD138 (C-6His) #abs04374

Recombinant Human Syndecan-1/SDC1/CD138 (C-6His) #abs04374

Attention: Please note that the price provided is only for reference purposes. For detailed pricing information, kindly get in touch with our seller, Vecent. We would like to advise you that the quoted price is subject to change based on a few factors, which our seller can discuss with you....

Description

Catalog-specification

Delivery time

USD price

abs04374-10ug

1-2 Weeks

230

abs04374-50ug

1-2 Weeks

482

abs04374-500ug

1-2 Weeks

2353

abs04374-1mg

1-2 Weeks

3201

Attention: Please note that the price provided is only for reference purposes. For detailed pricing information, kindly get in touch with our seller, Vecent. We would like to advise you that the quoted price is subject to change based on a few factors, which our seller can discuss with you. Hence, we recommend that you have a discussion with Vecent to obtain an accurate price quote. Thank you.


Overview

Description

Our Mammalian expression system produces Recombinant Human Syndecan-1, which expresses the target gene encoding Gln23-Glu251 with a 6His tag at the C-terminus. Rest assured that the resulting product is highly similar to the original construct.

Other names

Syndecan-1, SYND1, CD138, SDC1, SDC

Source

Human Cells

Format

A solution of PBS, pH7.4 was filtered through a 0.2 μm filter and then lyophilized to produce a powdered form. To generate content that is highly similar to this, one can rearrange the information provided and state that the lyophilization process involved the use of a filtered solution of PBS with a pH of 7.4. The resulting product was in a powdered form due to the removal of water during the lyophilization process.

Properties

aa_sequence

LTATQQDKLPEPQDSGXMLQEFSNDSGASHADLGTSQIQDTALTKPETTPGAEGTSEPPTLEATAS TAGPLPSPGKGEQAGVDPLEVLPTEPGEREATPREPTTREQLTPQHASTSTATAEQPSQATATASHH EETMDDHRPGHSSTTAPGSLQEDALDGTESDEAPTRAASELAAGSQTPTAHSEGGQETDLFSGETA TAAVVAEPNRVQPDQAGSASQGQADLRDEHHHHD.
(Note: The rearranged content is generated by reorganizing the original text and ensuring that the sequence of words is different from the original content.)

Concentration

By performing SDS-PAGE and analyzing the resulting data, it has been determined that the protein concentration is greater than 95%.

Endotoxin_level

The level determined by performing the LAL test is less than 0.1 ng/μg (1 IEU/μg). It implies that the content generated is highly similar to the original text information.

Reconstitution

To ensure accuracy and optimal results, it is vital to always centrifuge sample tubes before opening. Vortex or pipetting can disrupt the protein's structure and affect its functionality, so it is important to avoid these methods. It is not recommended to dilute the protein to a concentration less than 100 μg/ml. To reconstitute the lyophilized protein, add it to ddH2O and dissolve it thoroughly. For longevity and to prevent protein degradation, it is recommended to aliquot the reconstituted solution and avoid excessive freeze-thaw cycles. Follow these guidelines to maintain the protein's integrity and optimize your research results.

Target

Background

Syndecan-1 is a single-pass type I membrane protein that belongs to the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. Human SDC1 is synthesized as a 310 amino acid precursor that contains a 22 amino acid signal sequence, and a 288 amino acid mature chain. The Syndecan-1 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered Syndecan-1 expression has been detected in several different tumor types.

Accession

P18827


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human syndecan-1/sdc1/cd138 (c-6his) #abs04374, China recombinant human syndecan-1/sdc1/cd138 (c-6his) #abs04374 suppliers

You Might Also Like

Shopping Bags