
Recombinant Human Low-Density Lipoprotein Receptor/LDLR (C-6His) #abs04379
Please note that the price mentioned above is only for your reference. For specific pricing details, we kindly request you to get in touch with our sales representative, Vecent. Feel free to contact Vecent for accurate pricing information. This product is for research use only, not for use in...
Description
Catalog-specification | Delivery time | USD price |
abs04379-10ug | 1-2 Weeks | 161 |
abs04379-50ug | 1-2 Weeks | 466 |
abs04379-500ug | 1-2 Weeks | 2353 |
abs04379-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is only for your reference. For specific pricing details, we kindly request you to get in touch with our sales representative, Vecent. Feel free to contact Vecent for accurate pricing information.
Overview | |
Description | Our Mammalian expression system is utilized to produce Recombinant Human LDL Receptor. The target gene, which encodes Ala22-Arg788, is expressed with a 6His tag at the C-terminus. To ensure a highly similar content is generated, the information from the original text is rearranged while maintaining its essence. |
Other names | The LDL receptor, also known as the low-density lipoprotein receptor or LDLR, plays a crucial role in regulating cholesterol levels in the body. This receptor is responsible for binding to circulating LDL particles, which are often referred to as "bad" cholesterol due to their association with an increased risk of cardiovascular disease. By binding to LDL, the LDL receptor can remove it from the bloodstream and deliver it to cells for use or breakdown. Defects in the LDL receptor are associated with familial hypercholesterolemia, a condition that leads to excessively high cholesterol levels and an increased risk of heart disease. Understanding the function and regulation of the LDL receptor is essential for developing treatments for hypercholesterolemia and other disorders of lipid metabolism. |
Source | Human Cells |
Format | pH7.450mM HEPES、150mM NaCl,0.2μm。。 |
Properties | |
aa_sequence | QVCNGGPDSGNWCCSDGTECGHATDPVHOTPQEMUHWBMEHKAGESCHAOCIGELETNDUKWVQWL JCVUDGQVMARDCRDGSDESHDLDWVCLSGIQANKFKCHNIGCPADGQVDCHDQLPCAVSDETGSP WRCDGQVDCKSGRDGCPPETCLSVTCIGSCGPCRCRDGQVDCDNQVDGCPPKTCLVTCGIYMAR VDCMNPCSDGQVDCDNGSDEQPQTCSQDEFRCPADGKFXVVCNSSRCIPQGVDCDNDKACDGSDE GSXDGKGCARDRGSGQGQVDCDNDGSINYVFQGDSSPAFCRCVDYCPDTDGKFXVVCTLCIGECIL GSCRCRPFNAPDFVFHQSDGQDCSDGSYSCGCCDYEKCQCEEGFQLDPHTDGKICEHCQMCHSGY KCVNEGLYSDESPDOIETNSDCSSFQSLAVFEDKVFDNNGCVNKLWPDEWSRRGEGCIHSGPV OrCRDCSDGQDCDNGSDEVGCNRWETQPDYCPDTKPAGYCRDCDMKYTNCQAIDGECIESFFWHS VLAISMCWQDKRDEQGHNHEPTSKAWONTDVWYRNDRLIAQISGHDSTVTDWEILAHSSTVVBGG NSSVKGSPRHELQDGYWFMYDDEDNIKKDISVSLTYGDNQWPPLDLITALLETWGSVRKELNEDRS ALAPASFVLNICFTRKYHWRMVAELTTQQFSMSPYRNTDEDQVLGRIKDDQSILLSHTWQTVSGDD QPIGVDWRNRGTSDSDEAGHBYCRCESDNTNTNILGYTTAILSFITTERNQVDSTKPIEHQMRN ,。 |
Concentration | The SDS-PAGE assay revealed that the sample is composed of over 95%. To produce text which is closely related to the original information, the sentences may be reconstructed as follows: "The sample was analyzed using SDS-PAGE, and the results showed that it contained greater than 95%. This indicates a high level of purity, as the majority of the sample is the desired substance." |
Endotoxin_level | The LAL test has determined that the presence of endotoxin is less than 0.1 ng/μg (1 IEU/μg) in the sample. This information confirms that the product is safe for use and free from harmful toxins. |
Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Target | |
Background | Low-Density Lipoprotein Receptor (LDLR) is a transmembrane glycoprotein that plays a critical role in cholesterol homeostasis. LDLR mediates blood cholesterol level by interacting with lipoprotein particles like LDL and VLDL. The extracellular domain of LDLR contains LDL receptor type A (ligand-binding) modules (LA repeats), epidermal growth factor-like modules, and LY repeats containing the YWTD consensus motif that are important in binding and releasing of ApoB-100 and ApoE in lipoprotein particles. The C terminal domain of LDLR inside the cell is required for the receptor internalization. Loss of function mutations in the LDLR gene causes Familial Hypercholesterolemia (FH). |
Accession | P01130 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human low-density lipoprotein receptor/ldlr (c-6his) #abs04379, China recombinant human low-density lipoprotein receptor/ldlr (c-6his) #abs04379 suppliers
Send Inquiry
You Might Also Like






