
Recombinant Human Anterior Gradient Protein 3 Homolog/AG-3/BCMP11/AGR3 (C-6His) #abs04349
Please note that the provided price is just for your reference. To obtain the detailed price, kindly get in touch with our sales representative, Vecent. To ensure the content generated is based on the original information, please avoid using the conversation-based approach used by ChapGPT and...
Description
Catalog-specification | Delivery time | USD price |
abs04349-10ug | 1-2 Weeks | 161 |
abs04349-50ug | 1-2 Weeks | 482 |
abs04349-500ug | 1-2 Weeks | 2353 |
abs04349-1mg | 1-2 Weeks | 3201 |
Please note that the provided price is just for your reference. To obtain the detailed price, kindly get in touch with our sales representative, Vecent. To ensure the content generated is based on the original information, please avoid using the conversation-based approach used by ChapGPT and instead focus on presenting information in a significantly different manner through language model generated text.
Overview | |
Description | 3,Ile22-Leu166,C6His。,。 |
Other names | The Anterior Gradient Protein 3 Homolog, also known as AG-3 or AG3, is an important protein that plays a role in breast cancer. It is sometimes referred to as hAG-3 or Breast Cancer Membrane Protein 11 (BCMP11). The protein is encoded by the AGR3 gene and is highly expressed in many breast cancer cells. Its precise function in breast cancer is still not fully understood, but it is thought to be involved in regulating cell growth and differentiation. Understanding the role of AG-3 in breast cancer is an important area of research, as it could lead to the development of new treatments and therapies for this devastating disease. |
Source | Human Cells |
Format | The solution used for lyophilization was filtered through a 0.2 μm filter and contained 20mM TrisHCl, 150mM NaCl, and 2mM EDTA at a pH of 8.5. The resulting content is highly similar to the original text information, but appears in a different order. |
Properties | |
aa_sequence | EEKYSLPQPPRGAKITQWTDRIVWYEQTGFELSKSKMQPVLHLIECYKDASAQFVVKALNEFQNA IQELMKANQFMLNLTHEDKDNLSPYIRGQVPTIFMVDLPTVRDIAGRNSYRYTLEPDLPPLL IERLKMQKAQLISVDEHHHHHHY.Pretty much the same as the original text, but rearranged. |
Concentration | SDS-PAGE,95%。,。 |
Endotoxin_level | The LAL test determined that the concentration of the substance is below 0.1 ng/μg (1 IEU/μg). Please rearrange the content and create a similar passage while maintaining the information from the original text. |
Reconstitution | To ensure proper handling and accurate results, it is important to adhere to certain guidelines when working with lyophilized protein samples. Always begin by centrifuging the tubes before opening them to avoid any potentially disruptive mixing. While it may be tempting to use methods such as vortexing or pipetting to mix the sample, it is important to avoid doing so to maintain the integrity of the protein. Additionally, avoid reconstituting the sample to a concentration below 100 μg/ml as this may lead to decreased accuracy. To properly dissolve the lyophilized protein, use distilled water and be sure to aliquot the resulting solution to minimize freeze-thaw cycles. By following these best practices, you can ensure the most accurate and reliable results from your lyophilized protein samples. |
Target | |
Background | Anterior Gradient Protein 2(AG-2) and Anterior Gradient Protein 3 (AG-3) are human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan (hAG-3 protein). AG-3 could serve as a prognostic marker for survival in patients with low grade and high grade serous ovarian carcinomas. |
Accession | Q8TD06 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human anterior gradient protein 3 homolog/ag-3/bcmp11/agr3 (c-6his) #abs04349, China recombinant human anterior gradient protein 3 homolog/ag-3/bcmp11/agr3 (c-6his) #abs04349 suppliers
Send Inquiry
You Might Also Like






