Recombinant Human Fibroblast Growth Factor 12/FGF-12 #abs04191

abs04191-10ug

1-2 Weeks

123

abs04191-50ug

1-2 Weeks

337

abs04191-500ug

1-2 Weeks

2353

abs04191-1mg

1-2 Weeks

3201

Description

Our E.coli expression system enables the production of Recombinant Human Fibroblast Growth Factor 12. This system effectively expresses the target gene, which encodes Met1-Thr181.

Other names

FGF-12, also known as Fibroblast Growth Factor Homologous Factor 1 (FHF-1) or Myocyte-Activating Factor, is an important protein in the FGF family. FGF-12 plays a key role in cell growth regulation, differentiation, and embryonic development. It is also involved in neuronal signaling and function.
FGF-12 is encoded by the FGF12 gene, and it appears to have multiple isoforms, including FGF12B. This protein has been shown to interact with a number of different proteins and signaling pathways, making it an important regulator of a wide range of cellular processes.
Despite its widespread importance, the precise mechanisms of FGF-12 action remain poorly understood. However, research in this area is ongoing, and it is likely that new discoveries will continue to shed light on this important protein in the years to come.

Source

Escherichia coli.

Format

，20mM，150mM5mMpH7.50.2μm。

Properties

aa_sequence

VLYSQLGQPATLQSLFKKLKGQNMPKTLYVQIMMFGGFRGTEPDKDVDDGMKNDYGPNDFLSPHYTDGNQENMMGEYNCFLQHLRSSFLPRKVKVGRQQSLRQQVARLVSGTGPPMKSPTQEGVKIVPNSVFIADGRICKGFVIYEMYQYNEFSLQFHERANYWGKSSLPREFFVVDMGPCNQTLVMQDKEHGLSIVWSKTDEQSYVPYIV.

Concentration

As confirmed by SDS-PAGE analysis, the protein purity is above 95%. Can you please come up with another version of this statement, but with the same meaning?

Endotoxin_level

The LAL test has determined that the amount of IEU per μg is less than 0.1 ng/μg, indicating a highly desirable result. This demonstrates the quality and purity of the sample being tested.

Activity

The functional ELISA demonstrated that the ability of the protein to bind Human FGF R3 was highly effective, with an ED50 of less than 1.5 ug/mL. To create similar content, one could rephrase the above statement as: According to the results of a functional ELISA, it was found that the protein displayed a remarkable capacity to bind Human FGF R3 with an ED50 of less than 1.5 ug/mL.

Reconstitution

Make sure to always centrifuge the tubes before opening them. Avoid mixing the contents by vortex or pipetting. It is strongly advised not to reconstitute the protein to a concentration lower than 100 μg/ml. Start by dissolving the lyophilized protein in ddH2O. Remember to aliquot the reconstituted solution to minimize the number of freeze-thaw cycles.

Stability & Storage

The recommended storage conditions for lyophilized protein are below -20°C. However, if necessary, it can withstand room temperature for up to three weeks without significant degradation. For reconstituted protein solutions, it is advised to store them at temperatures between 4-7°C for a period of 2-7 days. Alternatively, if maintaining a lower temperature is preferred, storing aliquots of the reconstituted samples at below -20°C is suitable for up to three months while preserving their stability.

Target

Background

Fibroblast Growth Factor 12 (FGF-12) is a member of the fibroblast growth factor (FGF) family. FGF-12 is probably involved in nervous system development and function. FGF-12 lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfectedinto mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported.

Accession

P61328