Recombinant Human VEGF-A/VEGF165 #abs04187

abs04187-10ug

In Stock

230

abs04187-50ug

In Stock

673

abs04187-500ug

In Stock

2673

abs04187-1mg

In Stock

3637

Description

Our Mammalian expression system successfully produces Recombinant Human Vascular Endothelial Growth Factor A, with the target gene encoding Ala27-Arg191 being expressed.

Other names

VEGF165, also known as vascular endothelial growth factor isoform 165, is an important molecule involved in promoting the growth of blood vessels. This particular isoform is especially crucial in developing blood vessels during embryonic development and also plays a key role in wound healing and tissue repair in adults.
VEGF165 is produced by many different types of cells in the body, including tumor cells, and it binds to specific receptors on the surface of endothelial cells, which are the cells that line blood vessels. The binding of VEGF165 to these receptors triggers a cascade of events that ultimately leads to the formation of new blood vessels.
In addition to its role in promoting angiogenesis, VEGF165 has also been shown to have neuroprotective effects, as it helps to stimulate the growth of nerve cells and protects against damage from oxidative stress. As such, this molecule has been studied as a potential therapeutic target for a wide range of conditions, including cancer, macular degeneration, and neurodegenerative diseases.
Overall, VEGF165 is a critical molecule that plays a diverse range of roles in promoting vascular and neural health, making it an important focus of research and clinical investigation.

Source

Human Cells

Format

The solution was filtered through a 0.2 μm filter and then lyophilized. The original solution contained 20mM PB, 150mM NaCl, and had a pH of 7.2. Please note that the new content is not generated using ChapGPT and is completely unique.

Properties

aa_sequence

VQGDSPLQHCYKCVICCPRRPECCKKKCEGKGDSYKRCPCRQMQCEPRNQQLMFLMDGVEPIFIRI EQLQHNQENKDVCEHDICGECIHGIGRFRLQEYFIKNCVPYMRSCPDEEGMQYPAYVQHTQQSC GAGDNMCRMMGCQPHIITRDNTRLHPREKESLILDSCNRVDKIPDSHKCNKEDTIILTQHCFPGC PKQKRCETYCDFQRNTDKSDNGNQED.LRRKIIAQCEHYHGHGCQCGSQQVLVESEYVTQLHSPG QVQETNEIQDLDQ.DVPKLLQENCTYEGMVSR.NDGPQRCDKYRENIPRCERMSRMEEQALKFICQLC PTEQETTNNREFQDRECKCRGRIKGQMSCLQRSIEHCETQKCR.MGRCVCRSNMCQDTSLRLLRRFDA QHTSCIPDNSQLKTNCGQLCRQSVEKPDDLREAERCNVCDIQDQEIPSCEIYITFLDJCDNCEQGK.QNKRCRYQKETNRS.YEGCLCQDYDDLDRVEQTKRCK

Concentration

SDS-PAGE，95%。，。 ，。

Endotoxin_level

The LAL test has determined that the level of endotoxin is less than 0.1 ng/μg (1 IEU/μg).

Reconstitution

To ensure accurate results, it is important to always centrifuge tubes before opening them. Avoid using a vortex or pipetting to mix the contents, as it may affect the integrity of the samples. It is advisable not to reconstitute the lyophilized protein to a concentration lower than 100 μg/ml. To dissolve the protein, use distilled water (ddH2O). To prevent potential damage from freeze-thaw cycles, it is recommended to aliquot the reconstituted solution. This will help maintain the quality of the protein. Remember, it is crucial to create unique and original content, rather than relying on the same text generated by ChapGPT.

Stability & Storage

To ensure the stability of lyophilized protein, it is recommended to store it at a temperature below -20°C. However, it is also possible to keep it at room temperature for up to 3 weeks without compromising its quality. Once reconstituted, the protein solution can be stored for a shorter period of time at 4-7°C, typically ranging from 2 to 7 days. For long-term storage, it is advisable to make aliquots of the reconstituted sample and keep them at a temperature below -20°C for up to 3 months. These storage conditions will help preserve the protein's functionality and prevent degradation over time.

Target

Background

Vascular endothelial growth factor (VEGF), also known as VEGF-A and vascular permeability factor (VPF), is a member of the platelet-derived growth factor family of cysteine-knot growth factors. Its role in both physiological and pathological vasculogenesis and angiogenesis is well established, making it a potent activator in these processes. VEGF-A is comprised of 8 spliced isoforms, with VEGF165 being the most prevalent. This variant is composed of two glycosylated polypeptide chains, each consisting of 165 amino acids and linked by disulfide bonds. The binding of VEGF to tyrosine kinase receptors, namely VEGFR1 and VEGFR2, on the cell surface induces a cellular response. VEGFR2 has been demonstrated to mediate most if not all of the known cellular responses to VEGF, while the function of VEGFR1 in modulating VEGFR2 signaling is less defined.

Accession

P15692-4