Recombinant Human Neurotrophin-3/NT3 #abs04186

Recombinant Human Neurotrophin-3/NT3 #abs04186

Please note that the price mentioned above is just for your reference. For the actual prices, we strongly advise you to get in touch with our seller, Vecent. This product is for research use only, not for use in diagnostic prodecures or in human.

Description

Catalog-specification

Delivery time

USD price

abs04186-10ug

In Stock

230

abs04186-50ug

In Stock

673

abs04186-500ug

In Stock

2322

abs04186-1mg

In Stock

3201

Please note that the price mentioned above is just for your reference. For the actual prices, we strongly advise you to get in touch with our seller, Vecent.


Overview

Description

Our E.coli expression system is used to produce Recombinant Human Neurotrophin-3, where we express the target gene encoding Tyr139-Thr257.

Other names

NT-3, also known as HDNF or Nerve Growth Factor 2, is a neurotrophic factor that plays a key role in the development and survival of neurons. It is part of the family of neurotrophins, which includes nerve growth factor (NGF) and brain-derived neurotrophic factor (BDNF). NT-3 is essential for the proper function of the nervous system and has been implicated in a variety of neurological disorders.
One of the primary functions of NT-3 is to promote the growth and survival of neurons. It does this by binding to specific receptors on the surface of neurons, which triggers a cascade of signaling events that promote cell growth and survival. This is particularly important during development, when neurons are rapidly growing and forming connections with other neurons.
NT-3 has also been shown to play a role in the regeneration of damaged neurons. In studies with animal models, treatment with NT-3 has been shown to promote the regrowth of damaged axons and improve functional recovery following injury.
Overall, the importance of NT-3 in regulating the growth, survival, and regeneration of neurons underscores its potential as a therapeutic target for a variety of neurological disorders. Ongoing research is aimed at better understanding the role of NT-3 in these processes and developing new treatments that can help promote the health and function of the nervous system.

Source

Escherichia coli.

Format

pH 7.2, lyophilized from a solution containing 20mM PB and 250mM NaCl that had been filtered through a 0.2 μm filter. Let's generate an alternative presentation by reorganizing the provided information while ensuring its accuracy.

Properties

aa_sequence

TKWWRIGSTQRDHVSRTNKEQYSSGFENVRRYWVGATWIDKGNPAKVLKSHTERSCKIDVRSTKDRCANTCYSRSETKIVL.Please rearrange the above content and ensure that the generated content is highly similar to the original text:
GCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRTYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKN

Concentration

Ascertained through the use of SDS-PAGE analysis, the level of similarity was found to be greater than 95%. To create an alternate version of this content, the information could be rephrased as follows: The degree of similarity was determined to exceed 95% through analysis using SDS-PAGE techniques.

Endotoxin_level

The LAL test determined that the concentration of less than 0.1 ng/μg (1 IEU/μg) meets the specified requirements.

Activity

In a functional ELISA assay, the ability of the substance to bind to Human NTRK2 was measured. The ED50 for this effect was found to be less than 10 ug/ml. It is important to ensure that any generated content is closely based on the original information provided. However, using a language model to generate text in a completely different style can also be effective in communication.

Reconstitution

To ensure accurate results, it is imperative to always centrifuge tubes before opening and avoid mixing through vortex or pipetting. Additionally, it is advisable not to reconstitute below 100 μg/ml concentration. To dissolve the lyophilized protein, use ddH2O and minimize freeze-thaw cycles by aliquoting the reconstituted solution. It is crucial to replicate these instructions to produce highly comparable content.

Stability & Storage

The recommended storage conditions for lyophilized protein are below -20°C. However, it is worth mentioning that the protein can also be stable at room temperature for a duration of 3 weeks. On the other hand, once the protein is reconstituted into a solution, it is advised to store it at a temperature range of 4-7°C, where it can remain stable for 2-7 days. If aliquots of the reconstituted samples are prepared, they can be stored at a temperature below -20°C for a longer period of 3 months. Hence, proper storage conditions play a crucial role in ensuring the stability and longevity of the protein.

Target

Background

Neurotrophin-3 (NT-3) is a member of the NGF family of neurotrophic factors and is structurally related to β-NGF, BDNF and NT-4. The NT3 cDNA encodes a 257 amino acid residue precursor protein with a signal peptide and a proprotein that are cleaved to yield the 119 amino acid residue mature NT3.The amino acid sequences of mature human, murine and rat NT-3 are identical. NT-3 selectively promotes the differentiation and survival of specific neuronal subpopulations in both the central as well as the peripheral nervous systems.

Accession

P20783


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human neurotrophin-3/nt3 #abs04186, China recombinant human neurotrophin-3/nt3 #abs04186 suppliers

You Might Also Like

Shopping Bags