Recombinant Human Brain-Derived Neurotrophic Factor/BDNF #abs04185

abs04185-10ug

1-2 Weeks

230

abs04185-50ug

1-2 Weeks

673

abs04185-500ug

1-2 Weeks

2353

abs04185-1mg

1-2 Weeks

3201

Description

Our E.coli expression system is responsible for producing Recombinant Human Brain-Derived Neurotrophic Factor. This system effectively expresses the target gene, which encodes the region from His129 to Arg247.

Other names

BDNF, which stands for Brain-Derived Neurotrophic Factor, is a protein that plays a crucial role in the development, growth, and maintenance of neurons in the brain. It encourages the survival of existing neurons and promotes the growth of new ones, which enhances overall brain function and cognitive abilities.
Abri-neurin, a natural compound, has been shown to enhance the production and release of BDNF. This may potentially lead to improved brain health, enhanced brain function, and a decreased risk of age-related cognitive decline.
Overall, the connection between BDNF and Abri-neurin underscores the importance of maintaining healthy levels of BDNF in the brain. By doing so, we can improve our cognitive abilities and safeguard our brain health for the long-term.

Source

Escherichia coli.

Format

The solution of 20mM PB, 250mM NaCl, pH 7.2 was filtered through a 0.2 μm filter and then lyophilized.

Properties

aa_sequence

VVKQEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGRKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYT MHSDPARRGELSVCDSISEWVTAAD.

Concentration

The determination of the purity of the sample was carried out through SDS-PAGE analysis and it was found to be greater than 95%. A high level of similarity was observed indicating the uniformity and homogeneity of the sample. To confirm this result, further tests will be conducted to ensure the accuracy and reliability of the data obtained. Overall, the purity of the sample meets the required standards for the intended application.

Endotoxin_level

LAL，0.1 ng/μg（1 IEU/μg）。，。

Activity

According to the functional ELISA test, its binding ability to Human TrkB was measured. The effective dose, ED50, was found to be less than 5 ug/ml. Let me generate a revised content that conveys the same information but in a different manner.

Reconstitution

Please ensure to always centrifuge the tubes before opening them. Avoid mixing the solution by vortex or pipetting. We strongly advise against reconstituting the protein to a concentration lower than 100 μg/ml. Instead, dissolve the lyophilized protein in ddH2O. To minimize freeze-thaw cycles, it is recommended to aliquot the reconstituted solution. Kindly generate a content that is highly similar by rearranging the given instructions, making sure that the generated content is based on the original text information.

Stability & Storage

The stability of lyophilized protein is paramount, and it is recommended to store it at temperatures below -20°C. However, in an interim scenario, the protein can endure at room temperature for a span of three weeks without significant degradation.
On the other hand, once the lyophilized protein has been reconstituted into a solution, it is advisable to store it at a slightly higher temperature range of 4-7°C. This temperature range ensures the preservation of the protein's integrity for a period of 2-7 days, allowing for immediate usage or short-term storage.
For long-term storage, making aliquots of the reconstituted protein solution and storing them at temperatures below -20°C is the ideal approach. This methodology extends the stability of the protein for up to three months, allowing for multiple experimental uses without compromising its quality.
To summarize, proper storage conditions play a crucial role in maintaining the stability and integrity of lyophilized and reconstituted proteins. Following the recommended temperature ranges ensures optimal stability and extends the usability of the protein samples, providing researchers with reliable and consistent results.

Target

Background

Brain-Derived Neurotrophic Factor (BDNF) is a member of the neurotrophin family. Along with other structurally related neurotrophic factors NGF, NT-3 and NT-4, BDNF binds with high affinity to the TrkB kinase receptor. It also binds with the LNGFR (for low-affinity nerve growth factor receptor, also known as p75). BDNF promotes the survival, growth and differentiation of neurons. It serves as a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. BDNF expression is altered in neurodegenerative disorders such as Parkinson's and Alzheimer's disease.

Accession

P23560