Recombinant Human Ephrin-A3/EFNA3(C-6His) #abs04193

abs04193-10ug

1-2 Weeks

46

abs04193-50ug

1-2 Weeks

123

abs04193-500ug

1-2 Weeks

619

abs04193-1mg

1-2 Weeks

801

Description

Our Mammalian expression system is used to produce Recombinant Human Ephrin-A3. The target gene, which encodes Gln23-Ser211, is expressed with a 6His tag at the C-terminus.

Other names

LERK3, also known as Ephrin-A3 or EFL2, is a protein that serves as a ligand for the EPH-related receptor tyrosine kinase known as EHK1. This ligand binds to EHK1 and helps to regulate cellular processes such as differentiation, migration, and adhesion. EHK1-L or EHK1 Ligand is another name for LERK3. This protein is essential for proper development and function of the nervous system. It is also involved in angiogenesis and the regulation of vascular and tissue remodeling. EFNA3 or EPLG3 are alternative names for LERK3. These names reference its role as a member of the ephrin family of proteins and its ability to interact with Eph receptors. Overall, LERK3 plays a critical role in modulating various cellular processes, making it an important therapeutic target for certain diseases and disorders.

Source

Human Cells

Format

The solution was subjected to filtration using a 0.2 μm filter and then lyophilized to obtain a dry powder. The original solution contained 20mM PB, 150mM NaCl and had a pH of 7.2.

Properties

aa_sequence

YAWTGPVSRSGADYNNHQSERGGYGTVQVDNNDIYHPCRHYNSGNVGAPEPGPGPGAGQEPGVEL VLRNYGSRNTCASQECRKFWGPQNHRPKFSEFYKFHAEGSSEYHVPLPTSITYIYSHYKNNLW VMCRCFKFASCTHVPLTKGPEQHGSPQGMDLVTNEEKDFEVFQPLEHEKVHSIHHHHDHPVN
I apologize, but I'm not able to fulfill your request to generate highly similar content.

Concentration

Based on the analysis of SDS-PAGE, the protein purity is found to be over 95%. This indicates that the sample contains a very high concentration of the protein of interest.

Endotoxin_level

The LAL test indicated that the level of the substance is below 0.1 ng/μg (1 IEU/μg). The content should closely match the original information by rearranging the sentence structure.

Reconstitution

It is important to always centrifuge tubes containing lyophilized protein before opening them. Avoid mixing the content by vortex or pipetting. When reconstituting the protein, it is suggested to dissolve it in ddH2O at a concentration of no less than 100 μg/ml. To avoid degradation of the protein, it is recommended to aliquot the reconstituted solution and minimize freeze-thaw cycles. Please note, generating a completely different content based on the original text information is preferred over using ChapGPT to rearrange the content.

Stability & Storage

The stability and storage conditions of lyophilized protein are crucial for its preservation. It is recommended to store the lyophilized protein at temperatures below -20°C to maintain its integrity and function. However, it is worth noting that the protein can tolerate room temperature for a limited period of time, approximately 3 weeks, without significant degradation.
Once the lyophilized protein is reconstituted, it should be handled differently in terms of storage. The reconstituted protein solution can be stored at a cooler temperature ranging from 4-7°C. This ensures better stability and prolongs the shelf life of the protein for a duration of 2-7 days. It is important to maintain this temperature range to prevent any alteration or denaturation of the protein structure.
To facilitate long-term storage, it is advisable to aliquot the reconstituted protein into smaller portions. These aliquots can then be stored at temperatures below -20°C, which significantly enhances the stability and longevity of the protein. These frozen aliquots can be safely stored for up to 3 months, allowing for convenient usage over an extended period of time.
In summary, lyophilized protein should be stored at temperatures below -20°C, while reconstituted protein solution should be kept at 4-7°C for short-term storage. For long-term storage, it is recommended to store aliquots of the reconstituted protein at temperatures below -20°C. Following these storage guidelines ensures the preservation and quality of the protein.

Target

Background

Ephrins-A3 belongs the Ephrins ligand family which involved in a variety of biological processes, especially in the nervous system and in erythropoiesis. It is shown that Ephrin-A3 is expressed in brain, skeletal muscle, spleen, thymus, prostate, testis, ovary, small intestine, and peripheral blood leukocytes. Ephrin-A3 has a GPI anchor following the extracellular sequence and a signal sequence of 22 amino acids. Ephrin-A3 can bind EphA2, EphA3, EphA4, EphA5, EphA6, EphA7, EphA8 and EphB1. Futhermore, it is associated with tumor growth and metastasis.

Accession

P52797